SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004405 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004405
Domain Number 1 Region: 568-636
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000968
Family HLH, helix-loop-helix DNA-binding domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004405   Gene: ENSMPUG00000004438   Transcript: ENSMPUT00000004481
Sequence length 682
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897139.1:1935346:2325623:-1 gene:ENSMPUG00000004438 transcript:ENSMPUT00000004481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPQQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGMDERGGTTSW
GTSGQPSPSYDSSRGFTDSPHYSDHLNDSRLGAHEGLSPTPFMNSNLMGKTSERGSFSLY
SRDTGLPGCQSSLLRQDLGLGSPAQLSSSGKPGTPYYSFSASSSRRRPLHDSTALDPLQA
KKVRKVPPGLPSSVYAPSPNSDDFNRESPSYPSPKPPTSMFASTFFMQDGTHNSSDIWSS
SNGMSQPGFGGILGTSTSHMSQSSSYGSLHSHDRLSYPPHSVSPTDINTSLPPMSSFHRG
STSSSPYVAASHTPPINGSDSILGTRGTAAGSSQTGDALGKALASIYSPDHTSSSFPSNP
STPVGSPSPLTGTSQWPRPGGQAPSSPSYENSLHSLQSRMEDRLDRLDDAIHVLRNHAVG
PSTSLPAGHSDIHSLLGPSHNAPIGSLNSNYGGSSLVTSSRSASMVGTHREDSVNLNGNH
SVLSSTVTASSTDLNHKTQENYRGGLQSQSGTVVPAEIKTENKEKDENLHEPPSSDDMKS
DDESSQKDIKVSSRGRTSSTNEDEDLNPEQKIEREKERRMANNARERLRVRDINEAFKEL
GRMCQLHLKSEKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSAVSAE
PPTTLPGTHPGLSETTNPMGHM
Download sequence
Identical sequences M3XZA4
ENSMPUP00000004405 XP_004777362.1.14098 ENSMPUP00000004405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]