SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004433 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004433
Domain Number 1 Region: 6-315
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-85
Family Protein kinases, catalytic subunit 0.00000000133
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000004433
Domain Number - Region: 323-433
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0234
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004433   Gene: ENSMPUG00000004467   Transcript: ENSMPUT00000004510
Sequence length 454
Comment pep:known scaffold:MusPutFur1.0:GL897062.1:735637:745940:-1 gene:ENSMPUG00000004467 transcript:ENSMPUT00000004510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTFRQEDVEDYYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREE
IEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFL
KQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEY
FSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHPWIKAIRRRNVRREDSGRKPERRRLKTA
RLKEYTIKSHSSMPPNNTYVNFERFSKVLEEVAAAEEGLRGLEHSRRLCHEDIEALTAIY
AEKEAWYREENESIGQDLRRLRQELHKTEALQRQAQEEAKGALLGASGLKRRFSRLENRY
EALAKQVASEMRFVQDLVRAMEQEKLQGVECSLR
Download sequence
Identical sequences M3XZD2
ENSMPUP00000004433 ENSMPUP00000004433 XP_004771471.1.14098 XP_004771472.1.14098 XP_004771473.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]