SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004460 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004460
Domain Number 1 Region: 131-241
Classification Level Classification E-value
Superfamily PH domain-like 7.79e-34
Family Phosphotyrosine-binding domain (PTB) 0.0000577
Further Details:      
 
Domain Number 2 Region: 7-109
Classification Level Classification E-value
Superfamily PH domain-like 6.31e-17
Family Pleckstrin-homology domain (PH domain) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004460   Gene: ENSMPUG00000004496   Transcript: ENSMPUT00000004539
Sequence length 326
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896910.1:9944728:9951614:-1 gene:ENSMPUG00000004496 transcript:ENSMPUT00000004539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATNFNDIVKQGYVKMKSRKLGIYRRCWLVFRKSSSKGPQRLEKYPDEKSVCLRGCPKVT
EISNVKCVTRLPKETKRQAVAIIFTDDSARTFTCDSELEAEEWYKTLSVECLGSRLNDIS
LGEPDLLAPGVQCEQTDRFNVFLLPCPNLDVYGECKLQITHENIYLWDIHNPRVKLVSWP
LCSLRRYGRDATRFTFEAGRMCDAGEGLYTFQTQEGEQIYQRVHSATLAIAEQHKRVLLE
MEKNVRLLNKGTEHYSYPCTPTTMLPRSAYWHHITGSQNIAEASSYAGEGYGAAQASSET
DLLNRFILLKPKPSQGDSSEAKTPAQ
Download sequence
Identical sequences M3XZF9 U6CWN9
ENSMPUP00000004460 ENSMPUP00000004460 XP_004744307.1.14098 XP_004744308.1.14098 XP_004744309.1.14098 XP_004744310.1.14098 XP_012907599.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]