SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004530 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004530
Domain Number 1 Region: 374-724
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.07e-84
Family Protein kinases, catalytic subunit 0.00000201
Further Details:      
 
Domain Number 2 Region: 187-287
Classification Level Classification E-value
Superfamily MAST3 pre-PK domain-like 1.03e-44
Family MAST3 pre-PK domain-like 0.0000134
Further Details:      
 
Domain Number 3 Region: 960-1059
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-19
Family PDZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004530   Gene: ENSMPUG00000004565   Transcript: ENSMPUT00000004609
Sequence length 1571
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896921.1:1653177:1680567:-1 gene:ENSMPUG00000004565 transcript:ENSMPUT00000004609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSLWTALSNFSMPSFPGGSMFRRTKSCRTSNRKSLILTSTSPTLPRPHSPLPGHLGSS
PLDSPRNFSPNTPAHFSFASSRRADGRRWSLASLPSSGYGTNTPSSTVSSSCSSQERLHQ
LPYQPTVDELHFLSKHFGSTESITDEDGGRRSPAVRPRSRSLSPGRSPSSYDNEIVMMNH
VYKERFPKATAQMEEKLRDFARAYEPDSVLPLADGVLSFIHHQIIELARDCLTKSRDGLI
TTVYFYELQENLEKLLQDAYERSESMEVAFVTQLVKKLLIIISRPARLLECLEFNPEEFY
HLLEAAEGHAKEGHLVKTDIPRYIIRQLGLTRDPFPDVVHLEEQDSGGSNTPEQDDLSEG
RSTTTKAKKPPGENDFETIKLISNGAYGAVYLVRHRDTRQRFAMKKINKQNLILRNQIQQ
AFVERDILTFAENPFVVGMFCSFETRRHLCMVMEYVEGGDCATLLKNIGALPVEMARMYF
AETVLALEYLHNYGIVHRDLKPDNLLITSMGHIKLTDFGLSKMGLMSLTTNLYEGHIEKD
AREFLDKQVCGTPEYIAPEVILRQGYGKPVDWWAMGIILYEFLVGCVPFFGDTPEELFGQ
VISDDILWPEGDEALPTDAQLLISSLLQTNPLVRLGAGGAFEVKQHSFFRDLDWTGLLRQ
KAEFIPHLESEDDTSYFDTRSDRYHHVNSYDEDDTTEEEPVEIRQFSSCSPRFSKVYSSM
EQLSQHEPKTPVAAAGASKREPSAKGPEEKAAGKREGLGGLTLREKTWRGGSPEIKRFSA
SEASFLEGEASPPLGARRRFSALLEPSRFSAPQEDEDEGRLRRPPRPSSDPPGSLDARAP
KEAAQGDGTPSAGDLDATDRSRPGDLCPTSKDGDSSSPRATNDLVLRRARHQQLSGDPAV
EKRPSRTGGKVIKSASATALSVMIPAVDPHGSSPLASPMSPRSLSSNPSSRDSSPSRDYS
PAVSGLRSPITIQRSGKKYGFTLRAIRVYMGDSDVYSVHHIVWHVEEGGPAQEAGLCAGD
LITHVNGEPVHGMVHPEVVELILKSGNKVAVTTTPFENTSIRIGPARRSSYKAKMARRNK
RPSAKEGQESKKRSSLFRKITKQSNLLHTSRSLSSLNRSLSSSDSLPGSPTHGLPARSPT
HSYRSTPDSAYLGASSQSSSPASSTPNSPASSASHHIRPSTLHGLSPKLHRQYRSARCKS
AGNIPLSPLAHTPSPTQASPPPLPGHTVGSSHTTQSFPAKLHSSPPVVRPRPKSAEPPRS
PLLKRVQSAEKLGASLGADKKGALRKHSLEVGHPDFRKDFHGELALHSLAESDGETPPVE
GPGTPRQVAVRRLGRQESPLSLGADQLLPEGAPRPPVSSKEKESPGGAEACTPPRATTPG
GRTLERDPSGTRHQSVQTEDGVGGVARAVAKAALSPVQEHETGRRSSSGEAGTPPVPIVV
EPVRPGSKAVAPQPPGADSKGLQESTSLAPSVPEVPRGRECWVLEVVEERTTLSGPRSKP
TSPKLSPEPQASSPAPTKNAPSSAGPPVPPTSLLVPATKPEVGLTSRCPAETIPPAGLTK
KGAPCPTPPGP
Download sequence
Identical sequences M3XZM9
ENSMPUP00000004530 XP_004748398.1.14098 ENSMPUP00000004530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]