SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004552 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004552
Domain Number 1 Region: 472-761
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.69e-78
Family Extended AAA-ATPase domain 0.0000000000681
Further Details:      
 
Domain Number 2 Region: 200-462
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.36e-66
Family Extended AAA-ATPase domain 0.000000000671
Further Details:      
 
Domain Number 3 Region: 107-198
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 1.9e-35
Family Cdc48 domain 2-like 0.00000188
Further Details:      
 
Domain Number 4 Region: 22-105
Classification Level Classification E-value
Superfamily ADC-like 1.91e-28
Family Cdc48 N-terminal domain-like 0.00000818
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004552   Gene: ENSMPUG00000004587   Transcript: ENSMPUT00000004631
Sequence length 806
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896918.1:832308:846119:-1 gene:ENSMPUG00000004587 transcript:ENSMPUT00000004631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLK
GKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVHLGDVISIQPCPDVKYGKRIHVLPID
DTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDT
VIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRG
ILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAI
IFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRF
GRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAAL
QAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIG
GLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFI
SIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRV
INQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKAN
LRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAM
EVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGSFRFPSGNQGG
AGPSQGSGGGTGGSVYTEDNDDDLYG
Download sequence
Identical sequences G3X757 M3XZQ1
ENSBTAP00000019970 9615.ENSCAFP00000002927 XP_002929233.1.58354 XP_004392293.1.74151 XP_004747540.1.14098 XP_005900818.1.15283 XP_005970087.1.78601 XP_006064386.1.26621 XP_006739211.1.47382 XP_010844417.1.44457 XP_010951108.1.22495 XP_012003266.1.54773 XP_014934922.1.86478 XP_017527460.1.32401 XP_017907601.1.57651 XP_019310154.1.44245 XP_019821682.1.53367 XP_020736074.1.74333 XP_021547390.1.83697 XP_852626.1.84170 ENSMPUP00000004552 ENSMPUP00000004552 ENSBTAP00000019970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]