SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004594 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004594
Domain Number 1 Region: 816-993
Classification Level Classification E-value
Superfamily Macro domain-like 2.69e-48
Family Macro domain 0.0000968
Further Details:      
 
Domain Number 2 Region: 1025-1204
Classification Level Classification E-value
Superfamily Macro domain-like 3.53e-41
Family Macro domain 0.00024
Further Details:      
 
Domain Number 3 Region: 1636-1816
Classification Level Classification E-value
Superfamily ADP-ribosylation 5.37e-40
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.042
Further Details:      
 
Domain Number 4 Region: 1216-1403
Classification Level Classification E-value
Superfamily Macro domain-like 1.85e-38
Family Macro domain 0.0011
Further Details:      
 
Domain Number 5 Region: 1510-1617
Classification Level Classification E-value
Superfamily WWE domain 1.7e-17
Family WWE domain 0.0079
Further Details:      
 
Domain Number 6 Region: 224-298
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000333
Family Canonical RBD 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004594   Gene: ENSMPUG00000004629   Transcript: ENSMPUT00000004673
Sequence length 1817
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896912.1:18138990:18188368:-1 gene:ENSMPUG00000004629 transcript:ENSMPUT00000004673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPGSFPLRVEGSWGSYPPKNLSTKLQMYFQSARRSGGGECEVRQEPGTATRFLAFFHL
DAVRQRVLETKNHELLWPGIGTFQLTVQLPTATEEVQDVLEGDIPAKESETKAHIQEPEE
VSTELSPSRRWEKMEDTSEECENTSSSVAFENLKANVTDIMLILIVENVSGLPSDAFQVE
VLQDFDVAVVTFPTHVDAVKFVDNCVRHPFVKQLQLSPRLLEVTRTIRVENLPPGVDDYN
LKSLFENPQNGGGRIASIECLPEENSALIEFFDKKALHTIMTKKLDLDNMPLFVFPYYTS
LGTALYGKEKPLIKLPAPFRESLDLPLWRFLQKKRHLIDEINEEAIRCHSDLIWSELRCE
VTIRPATTLFCLGRLRIRNWKEDVSTAFSSIRSKYKVTPFKVDPVVWDTIKNNVGDDRIL
IEFDTLKGIVTLVGRSEDVQNIEPQVKELIESTTQKLKREEQSLKEKVAISPGRYFLLCH
RDVLGRLRTECPEMEICYDEDSQHVCFKGLYTDVYKAKCEIQKEMCTMVQKSIQLPPEIF
QFLQKGDCTEFSKSLFMAQKILAVCELEGKTVLLIGYSPKVLLDAEKQMVSAFSYKRINI
DDREVLNGKKWKALTHSLHKRHNSSSKTVIIDELTSETKAEVIIAGCVREVNESYSSLFD
FVEKHTKIERLIRINPPVIIDYLRIEKKPFWQKIKTTNVQVIFNLENKQKGILLIGPKAK
VLEGLNIVRQAVDSVCIENVHIDRPLVSQFFQEKAQYYKREVKRLFGCSIDLQENGGEGE
GGGRDGQSSSSQVELAPGVSLTMPQSSLSRVELAPGVWLMVQQGDLTRFPVEVVVSTAKE
DLQLCSSLAAALSKAAGPELQEACDQIVKTRGKIPPGSAVISKAGKLPYRHVIHAVGPEW
KDDEDLKCMLLLKRAVEETLRLAETHQCQSIAIPAISSGAGGFPLARCVKVIILAIKKNF
QCKQDGHTLKEIYLVDTAEKTVQAFAETVKTVFESVPSPTGPLPGLSQAVQPVLTNVPGN
RQISLSQGNLRLLLVEGDVQNATVDVLVNSIPMNLRLNTGLLSRALVTKAGPKLQEELDR
VGQAVVVGMGTVLRTSGHNLHCRNVLHVVAPHWRDGCTSSHKVMRDIIRKCLEITENLFL
RSIAFPAIGTGNLGFPKTVFAELITSEVLNFSSKIQLTALQEVQFLLHPSDHETIKAFSD
EFARRTNGNFVSAKVPKAEDTQGFRGTMPSSNVDVHEMKIGPVTFQVAFGDITKEEADVI
VNSTSKAFNLKAGVSRAILECAGQNVEMACSHLAEKGNSDYIVTEGGLLRCKNIVHVIGG
SDVKQSIFFVLQECEKRKYSSVCLPAIGTGNAQKDPEEVANAMIDAIEDSIQNGMLQSVK
KVKVVIFLPHLLDVFCDSMKKREASLASLQPSLRSKLTSFMKSPSPFPQKQNPLVLKKKT
ESASFQVCGESGKCIKNVVSWIQDLITKELCPYTYEDECIKDFNEKEYQKLNELQENLNI
AICLDYKRALIEVFGLGKDLTQARNAIEEMIKGMRLAKEQKSQAELISEFIEWQYCKNST
FQSFDKITNLQLETAWKAKKRKTVVKINHQSYTVDLTTHTATDAKGHSLPVQRLMKSEVK
TPEHWDDMKQQDFCVVELQPGHAEYNTVASKFNQTCSHFCIEKIERIQNPDLWNCYQTRK
KTMDTKNGHKNNEKQLFHGTDADSVPHVNRNGFNRSYAGKNAVAYGKGTYFAVDACYSAN
DIYSRPDSHGRKHMYYVRVLTGNYTRGNHSLIVPPPKSPENPTDLYDTVTDCVRNPHLFV
VFYDYQAYPEYLITFTN
Download sequence
Identical sequences M3XZU3
ENSMPUP00000004594 ENSMPUP00000004594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]