SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004647 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004647
Domain Number 1 Region: 89-225
Classification Level Classification E-value
Superfamily LigT-like 0.00000408
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004647   Gene: ENSMPUG00000004684   Transcript: ENSMPUT00000004728
Sequence length 280
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896910.1:10329669:10348205:1 gene:ENSMPUG00000004684 transcript:ENSMPUT00000004728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAPLVGYSSSGSEDEDEAEAAAGALARPGAGGCRRSQSPLPSQRLPVPDSVLHMFLDT
EGEPEDDQEKHGGRVRTFPHERGNWATHVYVPYETREDFLDLLDMLLAHAQTCVPRLVRM
EAFHVSLSQSVVLRHHWIIPFVQALKDRLASFQRFFFTANRVKIYTNQEKTRTFVGLEVT
SGHPQFLDLVSEVDRVMEEFDLTTFYQDPSFHVSLAWCVGDARLPLEGRCLRELQNIVDE
FEDPEMVLRAHAEQVRCKSGNKFFSMPLKCEPEPASDSET
Download sequence
Identical sequences M3XZZ6
ENSMPUP00000004647 ENSMPUP00000004647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]