SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004660 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004660
Domain Number 1 Region: 14-219
Classification Level Classification E-value
Superfamily PH domain-like 8.84e-54
Family Pleckstrin-homology domain (PH domain) 0.00000000595
Further Details:      
 
Domain Number 2 Region: 282-357
Classification Level Classification E-value
Superfamily SH3-domain 3.41e-16
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004660   Gene: ENSMPUG00000004697   Transcript: ENSMPUT00000004741
Sequence length 359
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896987.1:1331113:1500897:-1 gene:ENSMPUG00000004697 transcript:ENSMPUT00000004741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNPSSTSSPYPLPEEIRNLLADVETFVADTLRGENLSKKAKEKRESLIKKIKDVKSIYL
QDFQDKGDTEDGEEYDDPFAGPPDTVSLASERYDKDDEAHSEGNQFPPIAAQDLPFVLKA
GYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFSIDGYNVRMNNTLRKD
GKKDCCFEISAPDKRIYQFTAASPKDAEEWVQQLNFVLQDMGSDVIPEDDDERGELYDDV
DHPLPTSSPPASSQPIDDEIYEELPEEEEDNVPAQVEEQRKMNQDSALPSTGDKSTDYAN
FYQGLWDCTGALSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI
Download sequence
Identical sequences M3Y009
ENSMPUP00000004660 XP_004762587.1.14098 XP_004762588.1.14098 XP_004762589.1.14098 ENSMPUP00000004660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]