SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004682 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004682
Domain Number 1 Region: 996-1065
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000081
Family SAM (sterile alpha motif) domain 0.019
Further Details:      
 
Domain Number 2 Region: 906-983
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000314
Family SAM (sterile alpha motif) domain 0.028
Further Details:      
 
Domain Number 3 Region: 1077-1124
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000314
Family SAM (sterile alpha motif) domain 0.047
Further Details:      
 
Domain Number 4 Region: 258-411
Classification Level Classification E-value
Superfamily Tropomyosin 0.000085
Family Tropomyosin 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000004682
Domain Number - Region: 430-548
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00251
Family FCH domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004682   Gene: ENSMPUG00000004719   Transcript: ENSMPUT00000004763
Sequence length 1236
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896969.1:6769358:6838155:1 gene:ENSMPUG00000004719 transcript:ENSMPUT00000004763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRAWVFYFKMMCEVMPTISEAEGSPGGSGSHGSRSPSQPDADSHFEQLMVSMLEEKDRL
LDTLRETQETLALTQGKLHEVGHERDSLQRQLNTALPQEFATLTKELNVCREQLLEREEE
IAELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQSPAGVSSEVEVLKALKSLFEH
HKALDEKVRARLRVALERCGLLEEQLGATHKELMILKEQNNQKKTLTDGVLDMNHEQENT
PSTNGKRSSDGSLSHEEDLAKVLELQEIIDKQSEEQSQMKERLAALSSHVAELEEDLDTA
RKDLIKSEEANTKLQRDVREALAQKEDMEERITTLEKRYLAAQREATSVHDLNDKLENEI
ANKDSMHRQTEDRNRQLQERLELAEQKLQQTLRKAETLPEVEAELAQRVAALSKPDLLSS
GSGAAKEARLFELTSQLRKAEERHGNIEERLRQMEAQLEEKNQELQRARQREKMNEEHNK
RLSDTVDKLLSESNERLQLHLKERMAALEDKNSLLREVETAKKQLEEAQHDKDQLVLNVE
ALRAELDQTRLRGASLHHGRPHLGSVPDFRFPVADGPTDSYSSGAVLRRPQKGRLAALRD
EPSKVQTLNEQDWERAQQASVLANVAQAFESDVDVSDGEDDRDTLFSSAALLSPGGQADA
QTLAMMLQEQLDAINKEIRLIQEEKESTEQRAEEIASQVGSSTSDSPGRFRSGGAAPPHP
TSTLTGPSPPHSGRSTPRRGPHSPAREVDRLGVMTLVPASREEVRDDKATIKCETSPPSS
PRSLRLDRLHKGALHTASHEDIRDVRNSTGSQDGPGSNPSSSSSSQDSLHKAPRKKGIKS
SIGRLFGKKEKGRPGHAGKEPTGPAAASETENSSQDALGLGKLGGQAEKNRKLQKKHELL
EEARRQGLPFAQWDGPTVVVWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGI
SNPLHRLKLRLAIQEIMSLTSPSAPPTSRTTLAYGDMNHEWIGNEWLPSLGLAQYRSYFM
ECLVDARMLDHLTKKDLRGQLKMVDSLHRNSFQCGIMCLRRLNYDRKELEKKREESQNEI
KDVLVWSNDRVIRWILSIGLKEYANNLLESGVHGALMALDETFDANALALLLQIPTQNTQ
ARAVLEREFNNLLVMGTDRRFDEDDDKSFRRAPSWRKKFRPKDVRGLAAGSAETLPANFR
VTSLSSPSVQPKKMQLDGGVSGPQRLDSATVRTYSC
Download sequence
Identical sequences M3Y031
ENSMPUP00000004682 ENSMPUP00000004682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]