SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004693 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004693
Domain Number 1 Region: 29-211
Classification Level Classification E-value
Superfamily Macro domain-like 2.02e-42
Family Macro domain 0.00028
Further Details:      
 
Domain Number 2 Region: 233-406
Classification Level Classification E-value
Superfamily Macro domain-like 1.4e-41
Family Macro domain 0.00045
Further Details:      
 
Domain Number 3 Region: 443-621
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.49e-39
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004693   Gene: ENSMPUG00000004730   Transcript: ENSMPUT00000004774
Sequence length 622
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896912.1:18216946:18262598:-1 gene:ENSMPUG00000004730 transcript:ENSMPUT00000004774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGWLVFMLRGMLKDQVSGKNCLPDGNVIASAQTTEGLNLVLMAGNVTNFQAHVIVNTVS
QTLQLGNGPLSRAILQKAGPKLQEELYAVKQGAVEKIGSIFITSGCNLNCQAVFHVVAPT
WDNAAGRSQQIMANIIKKCLATVEELSFSSIVFPMIGTGNLRFPKAIFANLILSELFEFS
SRSWRKALQKVYLLVHLGDDEIQQAFLDEFTKGLYGNPNKDRILTTEGAFSPISSPGIIS
YGMKIGAITFQIATGDISKEKADVIVNSTTRTFNLKSGVSKAILEGAGPAVENECVVLAA
QPHRDFIVTQGGNLMCKIIIHVLGENDVRKTVSTVLEECEQRKYTSVSLPAIGTGNAGKN
PATVADDMISAVIDFARKHPIPSLRRVKVVIFLLELLHVFYDNMKKREKSTSPVLQPTRF
ETACNLPEHWADMNQQLSCVIELLPGQSEYDTIKDKFSETCPAYEIEKIERIQNVCIWQS
YQIKKNHMDMKNGHTDNERILFHGTDADSVPYVNEHGFNRSYAGKNGAAYGQGTYFAVNA
KYSANDKYSTPDSNGRKHVYVVRVLTGVYTCGHARLVTPPSKNPHNPTDLFDSVTDDTQH
PSLFVVFSDNQAYPEYLITFRC
Download sequence
Identical sequences M3Y042
ENSMPUP00000004693 XP_012908131.1.14098 ENSMPUP00000004693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]