SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004706 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004706
Domain Number 1 Region: 361-381,444-499
Classification Level Classification E-value
Superfamily SH3-domain 8.93e-24
Family SH3-domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004706   Gene: ENSMPUG00000004744   Transcript: ENSMPUT00000004788
Sequence length 500
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896969.1:6851788:6879078:1 gene:ENSMPUG00000004744 transcript:ENSMPUT00000004788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWKASAGHAVSITQDDVGSDDWETDPDFVNDVSEKEQRWGAKTVKGSGHQEHINIHKLRE
NVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRG
FGGKFGVQVDRVDQSAVGFEYQGKTEKHASQRDYSSGFGGKYGVQADRVDKSAVGFDYQG
KTEKHESQKDYSKGFGGKYGIDRDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQT
DRQDKCALGWDHQEKLQLHESQKDYSKGFGGKYGVQTDRMDKNASTFDDVAQVAPAYQKT
VPVEAVNSRTSNIRANFENLAKEKEQEDRRKAEAERAQRLAKERQEQEEARRQLHEQAQK
PTPPASPTPQPAQERPPPSPVYEDAASFRAEPEPMYSMEAAGYQEASSQQGPAYASDAVY
EATEAPGHYQTEENTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWW
RGLCRGRYGLFPANYVELRP
Download sequence
Identical sequences M3Y055
ENSMPUP00000004706 XP_012915427.1.14098 ENSMPUP00000004706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]