SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004712 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004712
Domain Number 1 Region: 207-432
Classification Level Classification E-value
Superfamily Macro domain-like 6.56e-54
Family Macro domain 0.0001
Further Details:      
 
Domain Number 2 Region: 444-623
Classification Level Classification E-value
Superfamily Macro domain-like 7.74e-36
Family Macro domain 0.0012
Further Details:      
 
Domain Number 3 Region: 785-965
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.17e-26
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004712   Gene: ENSMPUG00000004750   Transcript: ENSMPUT00000004794
Sequence length 995
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896912.1:18277728:18309033:1 gene:ENSMPUG00000004750 transcript:ENSMPUT00000004794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWVCLESRGARRLGTRSPGPPLTCRFRELHQEGDLVPVVEGLDGALPAAGLLALEVDFQ
LPACSTAGLGHPHEQRGRRGERGGHGSGLGAPGDGGQRVRPAPGSPGPSEFQFRFPRNPS
PRQAEPLPSPPLGALPAAVSWKQATILGITVYTGKRQMECKHLKTPETWRMDFPEGSYGA
VAHQETSEMATPEEDHSWQIFINHSDFTILKNNKSQLCEVLQNKFECVCTLVSPSVEGNS
ESLQVFREMLIPGLELSVWKDDLTRHAVDAVVNAANGDLIHGGGLAQALVKAGGSEIQEE
SRRLVSRFGKIPTGEITTTKAGRLPCKLIIHAVGPRWIAKDYQTCTYKLQTAIINILNYV
TFYNPDIETVAIPALSSGIFQFPLDLCTEIIVKTISLYYQGKQMATNLKEIHLVSNEHPT
VVAFKNASEVILRTNKLGSRMSEEATPPFKTVLVNNVTLQIVQGYIQLQETDVIVNSVNP
LCGLGFGAVSISILQQAGNEMELEFNEKITEILESQLVLVTRGFQLSCQYVYHVLWDLGH
HKLTEILRIAMKECLEKCLELNKTSISFPALGTGNFGIRKSVAAEIMFDEVLTFAKCHLK
KQLTVKFVIFPEELDTYVAFSTEMEKTKFKLRGFSNYNVPQLAREEKRENGLQAKSPAIS
LMGSNLEKMKEAQAWIQRILTPQDHHIIENNLILYLGKKEHDSLTRLQNTLRVSISEIIS
LEKATLEIKGAQADVIEAVMNIEHMLCEVQEEVARKKELALWSLSGQWTNWQPPNQDEMK
KNTFLKCLKLSTEEIQAQKKQFESCGLQVIKVEKIDNEVLMAVFQKKKKMMGERTQGKPV
SHRLFQQIPYQFCEAVSRVGFQRMYSAPCDQKYGVGIYFTKSLKNLAYRVKETSATDKLI
YVFEAEVLTGSFCQGHQLQITPPPLSPGDTDYHDSVVDNVSSPETFVIFSNTQAMPQYLW
TCSQDHVQPRDYSSRPRMQSSQQPRARFSRGSSVD
Download sequence
Identical sequences M3Y061
ENSMPUP00000004712 ENSMPUP00000004712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]