SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004716 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004716
Domain Number 1 Region: 601-741
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.93e-32
Family Synaptotagmin-like (S variant) 0.047
Further Details:      
 
Domain Number 2 Region: 3-147
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.59e-27
Family PLC-like (P variant) 0.000000976
Further Details:      
 
Domain Number 3 Region: 1419-1549
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.97e-23
Family Synaptotagmin-like (S variant) 0.02
Further Details:      
 
Domain Number 4 Region: 468-527
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000583
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004716   Gene: ENSMPUG00000004754   Transcript: ENSMPUT00000004798
Sequence length 1598
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896918.1:905375:1132993:1 gene:ENSMPUG00000004754 transcript:ENSMPUT00000004798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLCVRVKRAKFQGSPDKFNTYVTLKVQNVKSTTVAVRGDQPSWEQDFMFEISRLDLGL
SVEVWNKGLIWDTMVGTVWIALKTVRQSDEEGPGEWSTLEAETLMKDDEICGTKNPTPHK
ILLDTRFELPFDIPEEEARYWTYKLEQINVLGADSEYSSQEENQRKPLPTAAAQCSFEDP
DSAVDDRDSDYRSETSNSIPPPYHTTSQPNASVHQFPVPVRLPQQLLLQGNSRDSYNDSM
QSYDLDYPERRALSPTSSSRYGSSCNVSQGSSQLSELDQCHEQDDDHRERDSIHSCHSSG
SFSRDGQAGFGEQEKALEVTGEEEKGRAFEPKERKEDASIHSPPDLVLHKDHVLGPQESF
PEENASSPFTQARAHWIRAVTKVRLRLQEIPDDGHSSLPQWLPEGPAGGLYGIDSMPDLR
RKKPLPLVSDLSLVQSRKAGITSAMATRTSLKDEELKSHVYKKTLQALIYPISCTTPHNF
EVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSSKHGA
EDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVSKVAHVQQMKTVKQSVLDGTSKWSA
KITITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIFGNLNPVWEEKFHFECHNSSD
RIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSG
AIRLQISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGGVLIPEARGDDAWKVYFDE
TAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTN
VSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQDLKSTVDLLTSI
TFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSHQYQLKQELPPEEQGP
SIRNLDFWPKLITLIVSIIEEDKNSYTLVLNQFPQELNVGKVSAEVMWQLFAQDMKYALE
EHEKDRLCKSADYMNLHFKVKWLHNEYVRDLPALQGQVPEYPVWFEQFVLQWLDENEDVS
LEFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECPDPSILAHYMRR
FAQTIGKVLMQYANILSKSFPDYCTKEKMPCILMNNMQQLRVQLEKMFEAMGGKELDPEA
ADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADILGQVRGPGNASPNARASVAQ
DADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERMIVLPPLTDQTGTQ
LIFTAAKELSHLSKLKDHMVREETRSLTPKQCAVLDLALDTIKQYFHAGGNGLKKTFLEK
SPDLQSLRYALSLYTQTTDTLIKTFVRSQTAQGSGVDDPVGEVSIQVDLFTHPGTGEHKV
TVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNWAPKYNETFHFLLG
NEEGPEAYELQICVKDYCFAREDRVLGLAVMPLRDVAAKGSCACWCPLGRKIHMDETGQL
LFASQMFNPTEGAWTMIPLYRLDGGAINIPWEVKDKFF
Download sequence
Identical sequences M3Y065
ENSMPUP00000004716 ENSMPUP00000004716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]