SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004747 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004747
Domain Number 1 Region: 87-233
Classification Level Classification E-value
Superfamily PH domain-like 5.04e-27
Family Phosphotyrosine-binding domain (PTB) 0.009
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000004747
Domain Number - Region: 498-531
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00194
Family Ypt/Rab-GAP domain of gyp1p 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004747   Gene: ENSMPUG00000004785   Transcript: ENSMPUT00000004829
Sequence length 560
Comment pep:novel scaffold:MusPutFur1.0:GL896982.1:3039861:3233827:1 gene:ENSMPUG00000004785 transcript:ENSMPUT00000004829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHADDTSTKEDEKPELKIISNGDEQLEKAMEEILRDSEKGQSSLPVDCQSSTEISEHSF
GDISASQTNKPSLQLILDPSNTEISTPRPSSPSGLPEEDSVLFNKLTYLGCMKVSSPRNE
VEALRAMATMKSSSQHPFPVTLYVPNVPEGSVRIIDQSNNVELASFPIYKVLFCARGHDG
TTESNCFAFTESSHGSEEFQIHVFSCEIKEAVSRILYSFCTAFKRSSRQVTDVKDSIIPT
PDSDVFTFSVSLEVKEDDGKGNFSPVPKDRDKFYFKLKQGIEKKVVITVQQLSNKELAIE
RCFGMLLSPGRNVKNSDMHLLDMESMGKSYDGRAYVITGMWNPNIPIFLALNEETPKDKR
VYMTVAVDMVVTEVVEPVRFLLETVVRVYPANERFWYFSRKTFTETFFMRLKQSEGKGHT
SAGDAIYEVVSLQRQSEKEEPVTPTSGGGPMSPQEDEADEESDNELSSGTGDVSKDCPEK
ILYSWGELLGRWHSNLGARPKGLSTLVKSGVPEALRAEVWQLLAGCHDNQAMLDRYRLLI
TKHPGDCIAVNRTSEASSPA
Download sequence
Identical sequences M3Y096
ENSMPUP00000004747 ENSMPUP00000004747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]