SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004748 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004748
Domain Number 1 Region: 322-606
Classification Level Classification E-value
Superfamily TPR-like 2.72e-44
Family HAT/Suf repeat 0.0024
Further Details:      
 
Domain Number 2 Region: 85-260
Classification Level Classification E-value
Superfamily TPR-like 1.67e-36
Family HAT/Suf repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004748   Gene: ENSMPUG00000004786   Transcript: ENSMPUT00000004830
Sequence length 667
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896900.1:516139:557093:1 gene:ENSMPUG00000004786 transcript:ENSMPUT00000004830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQNSHMDEYRNSSNGSTGNSSEVVVEQSADFSTEIMNVTEMEQSPDGSPNVNAAAEENEV
TNAVDLPVTETEANFPPEYEKFWKTVESNPQDFTGWVYLLQYVEQENHLMAARKAFDKFF
IHYPYCYGYWKKYADLEKRHDNIKQSDEVYRRGLQAIPLSVDLWIHYINFLKETLDPGDP
ETNSTIRGTFEHAVLAAGTDFRSDRLWEMYINWENEQGNLREVTAIYDRILGIPTQLYSH
HFQRFKEHVQNNLPRDLLTGEQFIQLRRELASVNGHSGDDGPPGDDLPSGIEDITDPAKL
ITEIENMRHRIIEIHQEMFNYNEHEVSKRWTFEEGIKRPYFHVKPLEKAQLKNWKEYLEF
EIENGTHERVVVLFERCVISCALYEEFWIKYAKYMENHSIEGVRHVFSRACTIHLPKKPM
VHMLWAAFEEQQGNINEARNILRTFEECVLGLAMVRLRRVSLERRHGNMEEAEHLLQDAI
KNARSNNESSFYAIKLARHLFKIQKNLPKSRKVLLEAIERDKENTKLYLNLLEMEYSGDL
KQNEENILNCFDRAIHGSLPIKMRITFSQRKVEFLEDFGSDVNKLLNAYDEHQTLLKEQD
SLKRKAENGSEEPEEKKVHTEDTTSSSTQMIDGDLQANQAAYNYSAWYQYNYQNPWNYGQ
YYPPPPT
Download sequence
Identical sequences M3Y097
XP_004738766.1.14098 XP_004738767.1.14098 ENSMPUP00000004748 ENSMPUP00000004748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]