SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004749 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004749
Domain Number 1 Region: 206-445
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.23e-70
Family Nuclear receptor ligand-binding domain 0.000000000638
Further Details:      
 
Domain Number 2 Region: 95-182
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.13e-29
Family Nuclear receptor 0.0000957
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004749   Gene: ENSMPUG00000004787   Transcript: ENSMPUT00000004831
Sequence length 447
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896991.1:959603:965450:-1 gene:ENSMPUG00000004787 transcript:ENSMPUT00000004831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWLEAPVPDASPDSAAELWEPDAQDASSQSLGGNTCILREEASTPQSGGGSLGAGLEA
AEPAVLLPGVDTPPESTELRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKG
FFRRSVIKGARYVCHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLK
RLEEEQAQATSMPPRVSSPPQVLPQLSPEQRGMIEKLVAAQQQCNRRSFSDRLRVTPWPM
APDPQSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLL
ETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLI
AISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV
HSEQVFALRLQDKKLPPLLSEIWDVHE
Download sequence
Identical sequences M3Y098
XP_004763129.1.14098 XP_004763130.1.14098 XP_004763131.1.14098 XP_004763132.1.14098 XP_004763133.1.14098 XP_004763134.1.14098 XP_004763135.1.14098 XP_012917167.1.14098 XP_012917168.1.14098 ENSMPUP00000004749 ENSMPUP00000004749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]