SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004756 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004756
Domain Number 1 Region: 304-602
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.98e-83
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000225
Further Details:      
 
Domain Number 2 Region: 127-301
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.71e-44
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0004
Further Details:      
 
Domain Number 3 Region: 604-711
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.4e-25
Family Anticodon-binding domain of Class II aaRS 0.001
Further Details:      
 
Domain Number 4 Region: 64-125
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000214
Family TGS domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004756   Gene: ENSMPUG00000004795   Transcript: ENSMPUT00000004839
Sequence length 721
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897134.1:1638109:1652968:-1 gene:ENSMPUG00000004795 transcript:ENSMPUT00000004839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFYQRWRRLRLPGLQTCVLHTVREAAVPTPPHWLTERLGLFEELWTAQVKRLASMAQKE
QRTIKISLPGGQKVDAVAWNTTPYQLAQQISSTLADTAVAAQVNGELYDLERPLETDSDL
RFLTFSSAEGKAVFWHSSTHVLGAAAEQLLGAVLCRGPSTEYGFYHDFFLGKERTVRGSE
LPALERICQELRAAAQPFRRLEVSQDQLRQLFKDNPFKLRLIEEKVTGPMATVYGCGMLV
DLCRGPHLRHTGQIGGLKLLTNSSSLWRSSGAPETLQRVSGISFPTAKELRAWEEWKEEA
ELRDHRRIGKAQELFFFHELSPGSCFFLPRGTRVYNALVAFIKAEYTRRGFSEVKTPMLF
STKLWELSGHWEHYQEDMFALQPQGSDRLASSLSDHSASRPTDTLALKPMNCPAHCLMFA
HRPRSWRELPLRLADFGALHRAEASGSLGGLTRLRCFQQDDAHIFCAPDQLEAEIRGCLD
FLRSVYAVLGFSFRLALSTRPSGFLGEPCLWDQAEQVLQRALEEFGEPWDLNPGDGAFYG
PKIDVRLHDALGRPHQCGTIQLDFQLPLRFDLQYKGQAGVLERPVLIHRAVLGSVERILG
VLAESCGGKWPLWLSPFQVLVIPVGTEQEEYAREVQQRLQAAGLVCDLDADSGLTLSRRV
RRAQLAHYNFQFVVGQKEQSERAVNIRTRDNRRLGEWDLTEAVQRLLELQNTRVADAEAV
F
Download sequence
Identical sequences M3Y0A5
ENSMPUP00000004756 ENSMPUP00000004756 XP_012903458.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]