SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004765 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004765
Domain Number 1 Region: 652-964
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.47e-92
Family Protein kinases, catalytic subunit 0.0000000408
Further Details:      
 
Domain Number 2 Region: 211-288
Classification Level Classification E-value
Superfamily HR1 repeat 2.22e-24
Family HR1 repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 131-208
Classification Level Classification E-value
Superfamily HR1 repeat 2.49e-24
Family HR1 repeat 0.0000966
Further Details:      
 
Domain Number 4 Region: 27-106
Classification Level Classification E-value
Superfamily HR1 repeat 2.09e-20
Family HR1 repeat 0.00029
Further Details:      
 
Domain Number 5 Region: 380-479
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000034
Family PLC-like (P variant) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004765   Gene: ENSMPUG00000004804   Transcript: ENSMPUT00000004848
Sequence length 983
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896933.1:9702701:9830938:-1 gene:ENSMPUG00000004804 transcript:ENSMPUT00000004848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNPERGEILLTELQGDSRSLPFSENVSAVQKLDFSDTVVQQKLDDIKDRIKREIRKEL
KIKEGAENLRKVTTDKKSLAYVDNILKKSNKKLEELHHKLQELNAHIVVSDPEDVTDCPR
TPDTPSSDPRCSTSNNRLMALQKQLDIELKVKQGAENMIQMYSNGSSKDRKLHGTAQQLL
QDSKTKIEVIRMQILQAVQTNELAFDNAKPVISPLELRMEELRHHFRIEFAVAEGAKNVM
KLLGSGKVTDRKALSEAQARFNESSQKLDLLKYSLEQRLNELPKNHPKSSIIIEELSLVA
SPTLSPRQSMISTQNQYSTLSKPAALTGTLEVRLMGCQDILENVPGRSKATSVALPGWSP
SETRSSFMSRTSKSKSGSSRNLLKTDDLSNDVCAVLKLDNTVVGQTSWKPISNQSWDQKF
TLELDRSRELEISVYWRDWRSLCAVKFLRLEDFLDNQRHGMCLYLEPQGTLFAEVTFFNP
VIERRPKLQRQKKIFSKQQGKTFLRAPQMNINIATWGRLVRRAIPTVNHSGTFSPQAPVP
ATVPVVDVRIPELAPPASDSTVTKLDFDLEPEPPPAPTRDSSLGEIDESAKLRDSDTPGQ
GSETVFNIENDRNSILPKSPSEYEPDIPQPGLGYSGIRELEDRRSQQMFQFNLQDFRCCA
VLGRGHFGKVLLAEYKHTNEMFAIKALKKGDIVARDEVDSLMCEKRIFETVNSVRHPFLV
NLFACFQTKEHVCFVMEYAAGGDLMMHIHTDVFSEPRAVFYAACVVLGLQYLHEHKIVYR
DLKLDNLLLDTEGFVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTETSYTRAVDWW
GLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRRLLRRNPERRLG
AGEKDAEDVKKHPFFRLIDWSALMDKKVKPPFVPTIRGREDVSNFDDEFTSEAPILTPPR
EPRILSEEEQEMFRDFDYIADWC
Download sequence
Identical sequences M3Y0B4
XP_004752706.1.14098 ENSMPUP00000004765 ENSMPUP00000004765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]