SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004782 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004782
Domain Number 1 Region: 114-144
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000317
Family LIM domain 0.00077
Further Details:      
 
Domain Number 2 Region: 48-80
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000392
Family LIM domain 0.001
Further Details:      
 
Domain Number 3 Region: 83-113
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000485
Family LIM domain 0.0013
Further Details:      
 
Domain Number 4 Region: 18-48
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000211
Family LIM domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004782   Gene: ENSMPUG00000004821   Transcript: ENSMPUT00000004865
Sequence length 165
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896933.1:11096739:11112727:-1 gene:ENSMPUG00000004821 transcript:ENSMPUT00000004865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDI
GTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRN
RLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC
Download sequence
Identical sequences A0A096MM87 A0A0D9S6U1 A0A0P6J6I6 A0A1S3FWJ9 A0A1S3WK19 A0A1U7QYR6 A0A1U7T595 A0A250YAQ0 A0A286XLH6 A0A2K5DPW4 A0A2K5JJR5 A0A2K5NHK6 A0A2K5RBV6 A0A2K5TJE9 A0A2K5XY90 A0A2K6C2V8 A0A2K6FYC2 A0A2K6LKR7 A0A2K6PFE4 A0A2K6SLI0 A9ED91 E2QSI3 F6SNM6 F6XL10 F7H4J3 G1P3B9 G1RGS3 G1T3R8 G3QDN2 H0WKF1 H2N6V1 H2PZC3 I3M8B6 K7GBK1 M3Y0D1 P61968 P61969 Q3SWZ8 Q542S1 Q5PPG8 W5PZY9
ENSPTRP00000001601 ENSMPUP00000004782 ENSP00000359573 ENSP00000359575 ENSOCUP00000010877 ENSCAFP00000031798 ENSPVAP00000011830 ENSCJAP00000013766 ENSOGAP00000002047 ENSSTOP00000005959 ENSCAFP00000031798 ENSMICP00000002746 ENSNLEP00000012423 ENSNLEP00000023839 ENSGGOP00000000356 ENSCJAP00000013766 ENSCJAP00000019708 ENSTSYP00000005298 ENSTTRP00000000739 ENSPTRP00000001601 ENSEEUP00000011982 ENSOCUP00000010877 ENSOCUP00000027100 ENSRNOP00000012491 ENSMPUP00000004782 ENSOGAP00000002047 ENSBTAP00000000389 ENSPVAP00000011830 ENSPPYP00000001368 ENSMLUP00000004405 ENSTTRP00000000739 ENSPSIP00000017662 ENSMUSP00000029933 ENSECAP00000022722 ENSECAP00000022722 ENSSTOP00000005959 ENSP00000359573 ENSSSCP00000007387 ENSPSIP00000017662 ENSPPYP00000001368 ENSRNOP00000062436 10090.ENSMUSP00000113840 9598.ENSPTRP00000001601 9600.ENSPPYP00000001368 9606.ENSP00000359573 9796.ENSECAP00000022722 9823.ENSSSCP00000007387 9986.ENSOCUP00000010877 ENSBTAP00000000389 ENSGGOP00000000356 ENSSARP00000003105 ENSSARP00000003105 ENSOARP00000016025 ENSTSYP00000005298 ENSMUSP00000113513 ENSP00000359573 ENSP00000359575 ENSSSCP00000007387 gi|5803072|ref|NP_006760.1| ENSFCAP00000011086 NP_001009708.1.100692 NP_001009708.1.4139 NP_001029923.1.59421 NP_001029923.1.76553 NP_001106156.1.46622 NP_001155241.1.92730 NP_001155242.1.92730 NP_001244770.1.72884 NP_006760.1.87134 NP_006760.1.92137 NP_034853.1.92730 XP_001144677.1.37143 XP_001144748.1.37143 XP_001495634.1.31192 XP_002715924.1.1745 XP_002751086.1.60252 XP_002751087.1.60252 XP_002810690.1.23681 XP_002810691.1.23681 XP_002917710.1.58354 XP_003260067.1.23891 XP_003260068.1.23891 XP_003411156.1.64505 XP_003479098.3.53824 XP_003514658.2.69978 XP_003784224.1.62490 XP_003805357.1.60992 XP_003943313.1.74449 XP_003943314.1.74449 XP_004002215.1.66739 XP_004002216.1.66739 XP_004026136.1.27298 XP_004026137.1.27298 XP_004263040.1.21590 XP_004315052.1.83887 XP_004315053.1.83887 XP_004378768.1.4749 XP_004378769.1.4749 XP_004409009.1.74151 XP_004409010.1.74151 XP_004409011.1.74151 XP_004442966.1.5094 XP_004442967.1.5094 XP_004480976.1.11602 XP_004582131.1.84141 XP_004582132.1.84141 XP_004582133.1.84141 XP_004603360.1.94378 XP_004653721.1.11716 XP_004679243.1.23501 XP_004679244.1.23501 XP_005081975.1.91757 XP_005271348.1.92137 XP_005298154.1.60341 XP_005339180.1.77405 XP_005339181.1.77405 XP_005357440.1.66349 XP_005357441.1.66349 XP_005385172.1.28644 XP_005542866.1.63531 XP_005542867.1.63531 XP_005885377.1.60319 XP_005888482.1.15283 XP_005888483.1.15283 XP_005968270.1.78601 XP_006080556.1.26621 XP_006080557.1.26621 XP_006080558.1.26621 XP_006093965.1.53796 XP_006120309.1.96668 XP_006120310.1.96668 XP_006169754.1.99106 XP_006205980.1.17985 XP_006205982.1.17985 XP_006233500.1.100692 XP_006750394.1.47382 XP_006750395.1.47382 XP_006750396.1.47382 XP_006760859.1.95426 XP_006919445.1.64745 XP_006919446.1.64745 XP_006986176.1.50099 XP_007068810.1.26238 XP_007079221.1.5354 XP_007101555.1.24612 XP_007173119.1.59432 XP_007463337.1.90284 XP_007463338.1.90284 XP_007463339.1.90284 XP_007530020.1.11023 XP_007631074.1.28591 XP_007944372.1.48129 XP_007944373.1.48129 XP_007976250.1.81039 XP_007976251.1.81039 XP_008055229.1.4292 XP_008156006.1.99482 XP_008156007.1.99482 XP_008527827.1.77740 XP_008591608.1.73410 XP_008591609.1.73410 XP_008688854.1.72690 XP_008826516.1.79516 XP_008826517.1.79516 XP_008967976.1.60992 XP_008999880.1.60252 XP_010351474.1.97406 XP_010351475.1.97406 XP_010589439.1.64505 XP_010634975.1.5607 XP_010858646.1.44457 XP_010858647.1.44457 XP_011221277.1.58354 XP_011353895.1.92234 XP_011353896.1.92234 XP_011741437.1.29376 XP_011741438.1.29376 XP_011741439.1.29376 XP_011741440.1.29376 XP_011811463.1.43180 XP_011811464.1.43180 XP_011837478.1.47321 XP_011837479.1.47321 XP_011932411.1.92194 XP_011932412.1.92194 XP_011990020.1.54773 XP_011990021.1.54773 XP_012320222.1.9421 XP_012320223.1.9421 XP_012320224.1.9421 XP_012356019.1.23891 XP_012420876.1.74151 XP_012516602.1.63892 XP_012516603.1.63892 XP_012604698.1.48125 XP_012604699.1.48125 XP_012657201.1.62490 XP_012880207.1.60039 XP_012911649.1.14098 XP_012911650.1.14098 XP_012926367.1.39548 XP_012926368.1.39548 XP_014683048.1.49734 XP_014925863.1.86478 XP_014999363.1.72884 XP_014999371.1.72884 XP_015360210.1.40921 XP_015360211.1.40921 XP_015860206.1.50099 XP_016004000.1.101085 XP_016004001.1.101085 XP_016046728.1.11023 XP_016076142.1.3490 XP_017357450.1.71028 XP_017357451.1.71028 XP_017357453.1.71028 XP_017522455.1.32401 XP_017522456.1.32401 XP_017706426.1.44346 XP_017706434.1.44346 XP_017901188.1.57651 XP_017901189.1.57651 XP_019269609.1.44245 XP_019357113.1.87953 XP_019386692.1.79039 XP_019515470.1.44202 XP_019515471.1.44202 XP_019607322.1.88060 XP_019607323.1.88060 XP_019607324.1.88060 XP_019692941.1.62641 XP_019812707.1.53367 XP_019812708.1.53367 XP_020012709.1.5219 XP_020012719.1.5219 XP_020732898.1.74333 XP_020732900.1.74333 XP_020944107.1.46622 XP_020944108.1.46622 XP_021051453.1.100879 XP_021051454.1.100879 XP_021512871.1.76796 XP_021512873.1.76796 XP_021512874.1.76796 XP_021545723.1.83697 XP_021545724.1.83697 XP_537086.1.84170 XP_867313.1.84170 ENSEEUP00000011982 ENSMUSP00000113513 ENSMUSP00000113840 ENSMUSP00000113865 ENSMLUP00000004405 ENSNLEP00000012423 ENSMICP00000002746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]