SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004785 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004785
Domain Number 1 Region: 1534-1643
Classification Level Classification E-value
Superfamily PH domain-like 3.48e-24
Family Pleckstrin-homology domain (PH domain) 0.0035
Further Details:      
 
Domain Number 2 Region: 167-264
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.21e-20
Family FHA domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000004785
Domain Number - Region: 889-991,1535-1555
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0178
Family BAR domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004785   Gene: ENSMPUG00000004824   Transcript: ENSMPUT00000004868
Sequence length 1654
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896924.1:7466426:7512038:1 gene:ENSMPUG00000004824 transcript:ENSMPUT00000004868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRVISPIYSSSWQGLERAPREKQQCPPEPEAAAAEQGEGTRVPLSPREAPRWPAGRTLV
ESRPPAPHSSHSPADRRQRALHRARGPSWASSPPAPARPPLWTRNVCGVQPGGGGNPGDK
SWEPWSPRTMDALNRNQGGPGCKTQAMVKKGPLDLIETGKGLKVQTDKPHLVSLGSGRLS
TAITLLPLEEGKTVIGSAARDISLQGPGLAPEHCYIENVRGTLTLHPCGNVCSIDGLPVR
QPTRLTQGCMLCLGQSTFLRFNHPAEAKWMKSMIPAGGRAPGPPYSPGSESESLVNGNHA
AQPATRGPSACASHSSLVSSIEKDLQEIMDSLVLEEPGAAGKKPAATSPLSPMANGGRYL
LSPPTSPGAMSVGSSYENTSPAFSPLSSPASSGSCASHSPSGQEPAPSMPPLVPARSSSY
HLALQPPQSRPSGARASESPRLGRKGGHERPPSPGLRGLLTDSPAATVLAEARRATESPR
LGGQLPVVAISLSEYPASGARSQPTSIPGSPKFQPPVPAPRNKIGTLQDRPPSPFRELPG
TERVLTTSPSRQLVGRTFSDGSATRTLQPPESPRLGRRGLDSMRELPPLSPSLSRRVLSP
MPTRTAPDPKLPREVADSPRPRRWAAHGASPEDFSLTLGARGRRTRSPSPTLGESLAPRK
GSFSGRLSPAYSLGSLTGASPRQSPRAQRKLSSGDLRVPVTRERKNSITEISDNEDDLLE
YHRHQRQERLWEQEMERLERQRLETILNLCAEYSRADGGPEAGELPSIGEATAALALAGR
RTSRGLSGATGSNTEEPGGATQRLWECVERSDEENLKEECSSTESTQQEHEDAPGTKLQG
EVLALEEERAQVLGRVEQLKVRVKELEQQLQESAREAEMERALLQGEREAERALLQKEQK
AMDQLQEKLVTLETGIQKERDKERAELAAGRRHLEARQALYAELQTQVDNCPESVREQLQ
EQLRREAEALETETKLFEDLEFQQLERESRVEEERELAGQGLLRSQAELLRSITKRKERL
AVLDNQAGQIRAQAVQESERLAREKNASLQLLQKEKERLTVLEGRYHSLTGGRPFPKTMS
TLKEAELLISKAPEMGPGPATLVPFPGSSEPAASSVPLTPPASIQLCPRAQEYVTLEQLK
AMWGSSPVPTAPAPGLPFWASASRDLVPATCLPPVLPSSSSAPLTPSPKMEELLPPAVDL
EQWYQELMAGLGTGPAAASPRSSPPPLPAKASRQLQVYRSKMDGEATSPLPRTRSGPLPS
SSGSSSSSSQLSVATLGRSPSPKSALLAQNGTGSLPRNLAATLQDIETKRQLALQQKGQQ
VIEEQRRRLAELKQKAAAEAQCQWDALHGAAPFPPGPSGFPPLMHHSILHHLPAGRERGE
DGEHAYDTLSLESSDSMETSISTGGNSACSPDNMSSASGLDVAKIEEMEKMLKEAHAEKS
RLMESREREMELRRQALEEERRRREQVERRLQSESARRQQLVEKEVKMREKQFSQARPLT
RYLPIRKEDFDLKTHIESSGHGVDTCLHVVLSSKVCRGYLVKMGGKIKSWKKRWFVFDRL
KRTLSYYVDKHETKLKGVIYFQAIEEVYYDHLRSAAKKRFFSFSVVTESPNPALTFCVKT
HDRLYYMVAPSAEAMRIWMDVIVTGAEGYTQFMN
Download sequence
Identical sequences M3Y0D4
ENSMPUP00000004785 ENSMPUP00000004785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]