SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004858 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004858
Domain Number 1 Region: 41-135
Classification Level Classification E-value
Superfamily PDZ domain-like 4.99e-30
Family PDZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004858   Gene: ENSMPUG00000004898   Transcript: ENSMPUT00000004942
Sequence length 172
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897283.1:433418:463266:1 gene:ENSMPUG00000004898 transcript:ENSMPUT00000004942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TALYEMVYQYMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFN
VMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDS
VKLVVRYTPKVLEEMEARFEKLRTARRRQQQQQLIQQQQQQQQQQTQQNHMS
Download sequence
Identical sequences M3Y0K7
ENSMPUP00000004858 ENSMPUP00000004858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]