SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004875 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004875
Domain Number 1 Region: 306-346
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000137
Family TRASH domain 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000004875
Domain Number - Region: 587-606
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0293
Family Cytochrome c3-like 0.031
Further Details:      
 
Domain Number - Region: 820-830
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0968
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004875   Gene: ENSMPUG00000004915   Transcript: ENSMPUT00000004959
Sequence length 1373
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897138.1:1208548:1222680:-1 gene:ENSMPUG00000004915 transcript:ENSMPUT00000004959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPSDFPSPFDPLTLPEKPLAGDLPVDMEFGEDLLESQTAPTRGWAPPGPSPSSGALDLL
DTPAGLEKDPGVLDGATELLGLGGLLYKAPSPPEVDHGPEGTLAWDAGDQTLEPGPGGQT
AEVVPPEAGSGANPSSPEGLLEPLAPDSPITLQSPHVEEEETTNIATGRRGSPGQEEELP
QGQPQSPNGPPSPSVGETLGDGINSSQTKPGGPSPPAHPSLPGDGLTGKASEKPPERVQK
RSERVRRVEPPKPEVVDSTESIPVSDEDSDAMVDDPNDEDFVPFRPRRSPRMSLRSSVAQ
RAGRSAVGTKMTCAHCRTPLQKGQTAYQRKGLPQLFCSSSCLTTFSKKPSGKKTCTFCKK
EIWNTKDSVVAQTGSGGSFHEFCTSVCLSLYEAQQQRPIPQSGDPADATRCSICQKTGEV
LHEVSNGSVVHRLCSDSCFSKFRANKGLKTNCCDQCGAYIYTKTGSPGPELLFHEGQQKR
FCNTTCLGAYKKKNTRVYPCVWCKTLCKNFEMLSHVDRNGKTSLFCSLCCTTSYKVKQAG
LTGPPRPCSFCRRSLSDPCYYNKVDRTVYQFCSPSCWTKFQRTSPEGGIHLSCHYCHSLF
SGKPEVLDWQDQVFQFCCRDCCEDFKRLRGVVSQCEHCRQEKLLHEKLRFSGVEKSFCSE
GCVLLYKQDFTKKLGLCCITCTYCSQTCQRGVTEQLDGSTWDFCSEDCKSKYLLWYCKAA
RCHACKRQGKLLETIHWRGQIRHFCNQQCLLRFYSQQNQPNLDTQSGPESLLNSQSPESK
PQTPSQTKVENSNTVKTPEENGNLGKIPAKTRSAPTASTPPPPPPPPATPRKNKAAMCKP
LMQNRGVSCKVEMKSKGSQTEEWKPQVIVLPIPVPIFVPVPMHLYCQKVPVPFSMPIPVP
VPMFLPTTLESTDKIVETIEELKVKIPSNPLEADILAMAEMIAEAEELDKASSDLCDLVS
NQSAEGLLEDCDLFGPARDDVLAMAVKMANVLDEPGQDLEADFPKNPLDINPSVDFLFDC
GLVGPEDVSTEQDLPRTMRKGQKRLVLSESCSRDSMSSQPSCTGLNYSYGVNAWKCWVQS
KYANGETSKGDELRFGPKPMRIKEDILACSAAELNYGLAQFVREITRPNGERYEPDSIYY
LCLGIQQYLLENNRMVNIFTDLYYLTFVQELNKSLSTWQPTLLPNNTVFSRVEEEHLWEC
KQLGVYSPFVLLNTLMFFNTKFFGLQTAEEHMQLSFTNVVRQSRKCTTPRGTTKVVSIRY
YAPVRQRKGRDTGPGKRKREDEAPILEQRENRMNPLRCPVKFYEFYLSKCPESLRTRNDV
FYLQPERSCIAESPLWYSVIPMDRSMLESMLNRILAVREIYEELGRPGEEDLD
Download sequence
Identical sequences M3Y0M4
XP_004777282.1.14098 XP_012903688.1.14098 XP_012903689.1.14098 ENSMPUP00000004875 ENSMPUP00000004875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]