SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004897 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000004897
Domain Number - Region: 16-78
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0144
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004897   Gene: ENSMPUG00000004936   Transcript: ENSMPUT00000004981
Sequence length 451
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896987.1:4065355:4077946:1 gene:ENSMPUG00000004936 transcript:ENSMPUT00000004981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPVSASPWTPLPCHPKLRQVGTDTSNLRKADPKGRSALLADIQQGTRLRKVTQINDRSAP
QIESSKGTNKEGGGSANSRGGSTPPSLGDLFAGGFPVLRPAGQRDVAVGVCGSVRAEVGW
NRKAGPAPQPGGLSWAVAGAALSDKALKPQLAPLNLPPIPPPLPLLPPCGYPGLSADAAS
PTQDVREPPAPPPPPPPPPLYASCTPRSSVPAPPLPGANNNSEAPLLPPPKSPGFQAQPP
KSSAQALPTPPAPPGSQPFLQKKRPGRGPESIPTYTPIHTCPQTQRSTHTHTPTHTHARD
NLSLPPPPPEVSTDLQRNARPPKQNLGDRSQPTACSSHPPPPTHRTSGGKLNPPPAPPAR
SPTTELSSRSQQAPAWTPAQQPAGQLRNGSLHILEVSVRYWSKCADDFESKFTFHTMEDF
PPPDEYKPCQKIYPSKTPRKCLGLPLIPPLP
Download sequence
Identical sequences M3Y0P6
ENSMPUP00000004897 ENSMPUP00000004897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]