SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004901 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000004901
Domain Number - Region: 19-53
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00118
Family Ribosomal protein S14 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004901   Gene: ENSMPUG00000004940   Transcript: ENSMPUT00000004985
Sequence length 61
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896900.1:4574674:4575088:-1 gene:ENSMPUG00000004940 transcript:ENSMPUT00000004985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRESKMGHQQLYWSHPRKFGQGSRSCRVCSNRHGLIRKYGLNMCRQCFRQYAKDIGFIKV
R
Download sequence
Identical sequences M3Y0Q0
ENSMPUP00000004901 ENSMPUP00000004901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]