SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004906 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004906
Domain Number 1 Region: 92-167
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.83e-18
Family HLH, helix-loop-helix DNA-binding domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004906   Gene: ENSMPUG00000004945   Transcript: ENSMPUT00000004990
Sequence length 242
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897283.1:532532:536134:-1 gene:ENSMPUG00000004945 transcript:ENSMPUT00000004990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEE
HVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRT
VANPNQRLPKVEILRSAISYIERLQDLLHQLDQQEKMQELGVDPFSYRPKQENLEGADFL
RTCSSQWPSVSDHSRGLVITAKEGGASIDSSASSSLRCLSSIVDSISSEERKLPCVEEVV
EK
Download sequence
Identical sequences M3Y0Q5
ENSMPUP00000004906 XP_004781323.1.14098 ENSMPUP00000004906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]