SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004910 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004910
Domain Number 1 Region: 404-648
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 7.72e-45
Family Oxysterol-binding protein 0.003
Further Details:      
 
Domain Number 2 Region: 123-243
Classification Level Classification E-value
Superfamily PH domain-like 1.53e-21
Family Pleckstrin-homology domain (PH domain) 0.00000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004910   Gene: ENSMPUG00000004949   Transcript: ENSMPUT00000004994
Sequence length 862
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896969.1:7650924:7675723:1 gene:ENSMPUG00000004949 transcript:ENSMPUT00000004994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEEAFLRRRFSLCPPSSTPQKVDPRKLSRNLLFGGENELYPLSPGKDMEPNGPLPPRDE
GPPTPGSATKGPPAEYRLYNGSDKECVSPTAKVTKKEALKAQKENYRQEKKRATKQLFSA
LTDPSVVIMADSLKIRGTLKSWTKLWCVLKPGVLLIYKTPKVGQWVGTVLLHCCELIERP
SKKDGFCFKLFHPLDQSVWAVKGPKGESVGSITQPLPSSYLIFRAASESDGRCWLDALEL
ALRCSSLLRLSTCKQGRDGEPGSSPDASPASLCGLPPSAAIHDQDLCPLNGSSLENDAFS
DKSEQENAEESDNETQEHSGKTIGSGRAQSETLEGPVPRGTTYVEQVHEEFGEVRAHPLE
NRVSPCTSPASLNWGRGTLPGLSQKHPVCPSPLVRWRTWVSVGRAALEGDAYRRIKLVLQ
WYLSGFYKKPKGIKKPYNPILGETFRCCWFHPQTNSHTFYIAEQASPPHPETQAQRCDSR
KCFLGWGVGGGGWWGASRSPGALQIATWPTTPCLLPRAAGVIIIMYCACVSGILYGAMTM
ELGGRVTIECEKTNFQAELEFKLKPFFGGSTSINQISGKITSGEEVLAHLTGHWDREVFI
KEEGRGSAELFWNPSREVRGQRLRRRTVLLAEQTELESERDLLARWLQFASKQGAQYLTT
LVSQPLPFPACCSPSNQVAPPPSTGTDLDVPRGPPQPLQPTTPRPLLCSGQLAAVSQSHK
SCWRGPRNIRGPGPDRQLRKASDQPSGHSQVTESSSTPESCPELSDEEEEEEEEEEDGDF
IPGSESPCPRCGKEARRLQALHEAIVSIREAQQELHRHLSGMLSSAGRARQVPAPGLLQS
PRSWFLLCVFLACQLLINYILK
Download sequence
Identical sequences M3Y0Q9
ENSMPUP00000004910 ENSMPUP00000004910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]