SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004932 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004932
Domain Number 1 Region: 3885-4047
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.49e-33
Family SPRY domain 0.001
Further Details:      
 
Domain Number 2 Region: 3689-3880
Classification Level Classification E-value
Superfamily Fibronectin type III 1.97e-21
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 3 Region: 3493-3542
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000128
Family B-box zinc-binding domain 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000004932
Domain Number - Region: 3533-3651
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0523
Family BAR domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004932   Gene: ENSMPUG00000004971   Transcript: ENSMPUT00000005016
Sequence length 4054
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897022.1:548622:639920:-1 gene:ENSMPUG00000004971 transcript:ENSMPUT00000005016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSDSTYAAESPLGSDGDEEAPRRLESDEESESEEDETAAESEEEPDARLSDQDEEGKT
KQKCIISDPSFSMVTVQREDSGITWETNSSRSSTPWASEESQTSGVCSLEGSTMNSPPGN
VSFIVDEVKKARKRMPKSKRGSPSLRRKGNKKRNSLESQDVPANTKDNPLISESQVLSTQ
KEKSFAGIYDKTRKKKTTSNTPPITGAIYKEHKPLVLRPVYIGTVQYKIKMFNSVKEELI
PLQFYGTLPKGYVIKEIHYRKGKEASISLEPDMSNRDSNIVSQTGRLVGQSIEDDKVKQL
ASPWKAAFSKGSESLISSFRHEDEKKIYVDSPQKATSGTDHIASSFASNDTAEQEIQLSP
PESVPQQPGDEAKLCEMEPSSLTPDTSTPGFLETAKEEFEPDSQEIVTSEHESSVLPPLV
DEVKKEDVYSVDHSISLEAEKDSLEIGAPGLAASIEEDFGPEMEELDLTSPERAEPVSEQ
QNPPHLDIKGMEEENVPEPTISLSESLVLDEPKKEEVETSLPRAATPEPKDSNLVEEEVI
ELEYPESPSISKKPFSPYLAPEVEQKEEILLPSLKTSTRSDHVTSSEEEREENESVSTDS
AFVSEYSVPQDLNHELEKQEVELVSPSTIKGISEHPIFSEEENEEFEPLASASERSLSPS
TTEQTSECQSPLFSAALSESIGLSGEEASESGCYTPDSISASEYLTPSQATKESPMKTVD
HKSPLKSKGVSEHVILSEEKEDTGPYSLDVASASERSFSPSAAEQTSESQAPLFSTAMLE
QAGMSEEEDQGSERFAADSTLTSQNAVPPNATQEPPKKIIDDVSLLKSKDVSEHMTFSEE
KKESTGLYSPNVASVSEHSLPPSTAEQTSECQGPLFPTPTLEQAVMSEEKDLRSERFTAD
STLTSQNAVPTNVTQESPKKIIDDVSPLKSKGISEHMILSEEKEDTGLYSPNVASVSEHS
LPPSTAEQTSGCQAPSFAATASEHVVLSEETVEIERYTPSSTSTSEFSVPPHATPESQEE
EIVHRSPLNLKGASSPVNFSEEEQDIGPFSPDSAFVSEFSFSPYATQEAEKRELECDSPI
CLTSPSEHTILSDEDTEEVELFSPDSASQVSIPPYRIPETRKNEFEHDSLVTKISASGYS
CPSEADKEDLMPTAATPTPEHLGSSQKQQAKPSPSMSASKDLISPSSTNKREITEVEPDA
QTISTSISEYLILTQQQRTQAFSEPESEDLISPYSTSETEKGEIQTSSSVAATPVFSPAQ
SFMAKEDAKPVLHSSQYSASPDSVHEFQKEQETKASLTPKAANEQMALLKVKSKEETVPD
SQEATAHVLRDQEMELQPPNVLGPGMKYSVLPDLVDEPKKDVKPNLAPTVTSELEQRMLS
EKEPEVIKPYSPLKDTSLSGPEILSAVKMQVKHDSEIAGTPRVLHSVPSGVQEEAKHGPP
APEFSKEIKREIAPSCSITTTSITKHDSSLPKSGKEETPTGLSFTTPIEHPVLTKVEKNE
LGSGFPSLVTCIDDHSLLKEEKIARKTSFPTETAASEHPAWSEEEKEIKFDSPARISSLS
EHSLSKVETEEIKPGLPITKASLSQHSDVSKEERVENEQDRSFFTVLDSEQLVLSQKKTS
VSASEESGPERVLLLNQGGEVKKKETELPSSQSVSSAPKHIVPKDKNEEIGSSSPELENL
VSADLTLTPRGKNREIAEPSSTAQEDFLSERQDLALAELSLELEKKDKPHQVSELPSTAS
EFTRSLGEQDGSIDAKQTKSPITKTGDSVSEISEVSSCLREEPQIQEIKSFSPKVVSLRS
KETLMHLVEGDSLEKPQPHTFSLKGLSEKLNHSADIKTGGKQEISPLLSTGNLKTQVIGD
IERKLSEETDQPDSFRVPQSVTEPSKMVSSDLVEQEKPEKTLHSDQAVKLPDVSGSFADK
QGLGVKQFSFLKESLPLEESKSFITTEFADIKETQMQEALFVPKNESWMLEKPERDLASQ
QEEGILESVELGSSGSNDLKTGHLKAALLDKDHTCETRKQLLPHSAEESPLSLGEPVCTL
STSSGDIETLSTKTYSSEETKLAPKPKSLVPTRNVEINEAEEKQILPSVGSESLILEKAT
PDSSRPCKEGSQEEIKPLSERIHQKPVSDPSVGEIKSETIPSPTKAAQFLAEDAEPALGK
EKEAHRSISPLPREKPLEEAKVLHSKVVDDVNKRGKPASEVKISTPIEPLSSMQENEESQ
LAEPLEVTQKLPKQQKVVEPGLSEEKGKKGILSFTSWMSSLFFGSSTPEKKVAEKDLEAQ
PSPSVEKSSPVTGSERTASADSNATEKAADRLLPEAKLKTAEKSRGTSVKSGEGQEFEEE
KPTSLSNVEILQQPKSNSEVSSEDYRKKEILDYSEEMDLNSVVASADGEKHLEIQSYPPM
GEKSIVEEVQNAVPLHITDSKRAQKPEISDPSKWNVSTLKKEPRSDQREKLLFSFDAVDK
VPQQPKSASSGFTSKNITEESEKPETIILPVEESKCSLIDLSEDRLKKEMLKPTSLKTSE
EETKLRPVSPTEEKGDLITRSYSVAEKKVLAEKQETVAPLEFRDNELGKAQTIKLEESKA
VAVLQQVSQNEEHTERYTIMKQEKEEKPNQSQVFPDGKQQQEIQPYSVNVVRSKPEESDI
SLSPPLDETQPFSLVKTVSATEKSETMLLEGRPEIREPRAVGVQPHPREESKVLVEKIKM
FLPADLPYHDEKDNYSSPREGNLIVEKSSRDMASHNEEKGHVTVAEPSKGGSIDATKEST
KQGSPSKESERILDHHFDETKSLETPPYLLSSVKSQTLVSGTSPEMNAVKKQEIPWSELT
PDRHTVQTIQTSKDLTSEMSKQSVLASKHHMEVVEDTHVSEPHSSASSNYAQFIKNASAI
NAGRMVPHREISKEPEDTYVKGEDFTVTSKPAGLSEDQKSAFNIISEGCEILNIHASAFI
SSVDQEESEQMQDKLEYLEEKASFRTISLHDSSEAVPCHKTLKSELEDSDQVISLQENKR
KESLNTKREVPTDSETDDFTFNQPTAPSDEDYFEKYTLIDYNISPDPEKQKAPWKLNVEV
ELPKEVTQDTVSFPERSEEGALEHEYDLVKLDESFYGMEKDYSKSSHPETQKPLGIQQSA
DRDASKNINRDVDLKSPGMPLFGAEEGVLSPTQIFPTTTKAINPELLEEPPALAFLYKDL
YEEAVGEKKKEGETASEGDSVNSEASFPSRNSDTDDGTGIYFEKYILKDDILHGTSVSQK
DQGQGLEEKGVGKDDSYKLIAAEGEIWGRFGTVLGEKSLEEEQKATYREEESVCHVETLD
IEAMQGKAPITEEVTVVTQKVSYAVPFEDTHHVLERADETNSQNNEAASASPEVNLNVPV
QVSFPEEEFASGVTCVQETLQEESKIMVPSEQSEDRLRSSPVQDEYEFAESLNYEMVAQD
TLSEELYSESTPEDVLSQGKESFEHVSENEFVSEVEQSMSVEQKELGGEKAEQEQLLSES
ATEKEQKEPKKSQIDTYCYTCRNPISAVDQMFGMHKDHEVATLDTAINAVKVQLAEFLDN
LQEKSLRIEAFVSEIESFFNTIEENCSKNEKKLEEQNEEMMKKVLAQYDEKAQSFEEVKK
RKMEFLHDQMVRFLQSMDTAKDTLESIVREAEELDETVFLTSFEEINERLLSAMESTASL
EKMPAAFSLFEHYDDSSARSDQMLKQVAVPQPPRLEPQEPNSATSTTIAVYWSMNKEDVI
DSFQVYCMEEPQDDQEVNDLVEEYRLTVKESYCIFEDLEPDRCYQVWVMAVNFTGCSLPS
ERAIFRTAPSTPVIRAEDCTVCWNMATIRWRPANPEATETYTLEYCRQHSPEGEGLRSFS
GIKGLQLKVNLQPNDNYFFYVRAINAFGASEQSEAALISTRGTRFLLLRETAHPALQISS
DGTVISFTERRRLTEIPSVLGEELPACGQHYWETTVTDCPAYRLGICSHSAVQAGTLGHG
ETSWYMHCSGPQRYTFFYSGIVSDVHVTERPARVGILLDYNNQRLLFINAESGQLLFIIR
HRFNEGVHPAFALEKPGKCTLHLGIEPPDSTRHK
Download sequence
Identical sequences M3Y0T1
ENSMPUP00000004932 ENSMPUP00000004932 XP_004766865.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]