SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004935 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004935
Domain Number 1 Region: 840-1117
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-72
Family Protein kinases, catalytic subunit 0.00000423
Further Details:      
 
Domain Number 2 Region: 521-812
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.97e-48
Family Protein kinases, catalytic subunit 0.000071
Further Details:      
 
Domain Number 3 Region: 369-498
Classification Level Classification E-value
Superfamily SH2 domain 6.83e-18
Family SH2 domain 0.0032
Further Details:      
 
Domain Number 4 Region: 277-384
Classification Level Classification E-value
Superfamily PH domain-like 5.16e-16
Family Third domain of FERM 0.016
Further Details:      
 
Domain Number 5 Region: 139-259
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000141
Family Second domain of FERM 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004935   Gene: ENSMPUG00000004974   Transcript: ENSMPUT00000005019
Sequence length 1130
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897017.1:2198958:2336095:-1 gene:ENSMPUG00000004974 transcript:ENSMPUT00000005019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACLTMTEMEGTSVSPVHQNGDVPGNANPVKQIDPLLQVYLYHSLEKAEGEYLKFPTGEY
AAEEICVAASKACGITPVYHSMFALMSETERIWYPPNHVFHIDESTRHNVLYRIRFYFPY
WYCNGSNRTYRYGISRGAETPLLDDFVMAYLFAQWRHDFLHGWIKIPVTHETQEECLGMA
VLDMMRLAKEKDQTPLDIYSSISYKTFLPKCVRAKIQDYHILTRKRIRYRFRRFIEQFSH
CKATARNLKLKYLINLETLQSAFYTEQFEVKEPGRGPSGEEIFATIIITGNGGIQWSRGK
HKESETLTEQDLQLYCDFPDIIDVTIKQASQEGSNESRIVTIHKQDGKNLEIELSSLKEA
LSFVSLIDGYYRLTADAHHYLCKEVAPPMVLENIQSNCHGPILMDFAISKLKKAGNQTGL
YVLRCSPKDFNKYFLTFAVERENAIEYKHCLITKNENGEYNLSGTKKNFSNLKDLLNCYQ
METVRSDSIIFQFTKCCPPKLKDKSNLLVFRTSGISDVPTSPTLQRHNNVNQMVFHKIRN
EDLMFNESLGQGTFTKIFKGIRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMS
QLSHKHLVLNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNSINILWKLEVAKQLAWAMH
FLEEKALVHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVPPE
CTENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWTELAN
LINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRDPT
QFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEIL
KSLQHDNIVKYKGVCYSAGRRNLRLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQICK
GMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYA
PESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELL
KNNGRLPRPDGCPDEIYLIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Download sequence
Identical sequences M3Y0T4
ENSMPUP00000004935 ENSMPUP00000004935 XP_004766235.1.14098 XP_012918786.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]