SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004942 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004942
Domain Number 1 Region: 297-439
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-40
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 193-298
Classification Level Classification E-value
Superfamily Second domain of FERM 1.02e-36
Family Second domain of FERM 0.00000297
Further Details:      
 
Domain Number 3 Region: 112-192
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-27
Family First domain of FERM 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004942   Gene: ENSMPUG00000004981   Transcript: ENSMPUT00000005026
Sequence length 1094
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896906.1:11249147:11336508:1 gene:ENSMPUG00000004981 transcript:ENSMPUT00000005026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTESGSDSESKPEQEAEPQEAVGAQGHAGAPQGPGPEPSGEEQHQALEQFQAAAHSTPV
RKEVTDKEREFAAGAAKQLEYQQLEDDKLSQKSSSSKLSRSPLKIVKKPKSMQCKVILLD
GSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQIRSG
AWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELG
DYDPDECGNDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGV
DLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQ
FESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQTRR
ASALIDRPAPYFERSSSKRYTMSRSLDGASVNENHEIYMKDSVSAAEVGTGQYATTKGIS
QTNLITTVTPEKKTEEERDEEEDRRKKAEEVTPVAAVRHEGKSPGLGTDSCPLSPPSAPR
PPASPPGLRRRCKENERQAPDLEAARGTVRVLREPAMDSDPKGKPSLGDQDVAFSYKQQT
GKGTTLFSFSLQLPESFPSLLDDDGYLSFPNLSETNLLPQSLQHYLPIRSPSLVPCFLFI
FFFLLSASFSVPYALTLSFPLAMCLCYLEPKAASLSASLDNDPSDSSEEETDSERTDTAA
DGETTATESDQEEDAELKAQNSLIKRIKGENVYVKHSNLMLEELDKTQDDLMKHQTNISE
LKRTFLETSTDTAITNEWEKRLSTSPVRLAARQEDAPMIEPLVPEEKTETKTGSSKTETE
TSQHPEPLSTEKVVQETVLVEERNVMNVHASGDASYAAGDDADAAAQAASADASSLKGKE
GSALMEGAKEEKEKVADKAVLEQEETATASHEPEEQQSTTIHVSETWEQKPHFESSTVKT
ETISFGSVSPGGAKLEISTKEVPVVHTETKTITYESSQVDAGADLEPGVLMSAQTITSET
TSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVTKVV
VHKETEITPEDGED
Download sequence
Identical sequences M3Y0U1
ENSMPUP00000004942 ENSMPUP00000004942 XP_012906867.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]