SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004973 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004973
Domain Number 1 Region: 11-115
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.4e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004973   Gene: ENSMPUG00000005012   Transcript: ENSMPUT00000005058
Sequence length 520
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896991.1:1023636:1032772:1 gene:ENSMPUG00000005012 transcript:ENSMPUT00000005058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEPSKTEIQTLFKRLRGIPTNKACFDCGAKNPSWASITYGVFLCIDCSGVHRSLGVHL
SFIRSTELDSNWNWFQLRCMQVGGNANATAFFRQHGCTASDANTKYNSRAAQMYREKIRQ
LGSAALARHGTDLWIDNMSNAASHSPEKKDSDFFTEHSQPPAWKVPAPDPAETQQLAPSA
EISSLAQPEQGPNMDLLGTSPKASLEPRTSLIGKKKPAGAKKGLGAKKGLGAQKVSSQSF
SEIERQAQVAEKLREQQAADAKKQAEESMVASMRLAYQELQIDRKKEEKKLQNLEGKKRE
QAERLGMGLVSRSSVSHSVLSEMQVIEQETPVSAKSSRSQLDLFDDVGTFASGPPKYKDN
PFSLGESFSSRWDSDAAWGMDRTEEKEPEVTISSIRPLSERVTNRREVESQSSGLESSEA
RQKFAGAKAISSDMFFGREVDAEHEARSRLQQLSGSSAISSSDLFGDVDGTHGAGSVSLG
NVLPTADIAQFKQGVKSVAGKMAVLANGVMNSLQDRYGSY
Download sequence
Identical sequences M3Y0X2
XP_004763174.1.14098 ENSMPUP00000004973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]