SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004977 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004977
Domain Number 1 Region: 213-449
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.97e-57
Family DBL homology domain (DH-domain) 0.0000408
Further Details:      
 
Domain Number 2 Region: 450-569
Classification Level Classification E-value
Superfamily PH domain-like 4.48e-31
Family Pleckstrin-homology domain (PH domain) 0.0007
Further Details:      
 
Domain Number 3 Region: 28-88
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000897
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004977   Gene: ENSMPUG00000005016   Transcript: ENSMPUT00000005062
Sequence length 909
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897177.1:999776:1013200:1 gene:ENSMPUG00000005016 transcript:ENSMPUT00000005062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGRLVPSASLPVSLPLAQAREKEKMKEAKDARYTNGHLFTTISVSGMTMCYACNKSITAK
EALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNNTALQSVSLRSKTTPRERPSSA
IYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNEESPLGLRRILSQSTDSLNMRNR
TLSVESLIDEGAEVIYSELMSDFETDERDFAADSWSLAVDSGFLQQQKKEVMKQQDVIYE
LIQTELHHVRTLKIMTRLFRAGMLEELQLEPGVVQGLFPCVDELSDIHTRFLSQLLERRR
QSLCPGSTRNFVIHRLGDLLINQFSGPSAEQMRKTYSEFCSRHTKALKLYKELCARDKRF
QQFIRKVTRSAVLKRHGVQECILLVTQRVTKYPVLISRILQHSHGPEEERQDLTTALGLV
KELLSNVDQDVHELEKGARLQEIYHRMDPRAQAPVPGKGPFGREELLRRRLIHDGCLLWK
TATGRFKDVLMLLMTDVLLFLQEKDQKYIFPALDKPSVVSLQNLIVRDIANQEKGMFLIS
AAPPEMYEVHTASRDDRSTWIRVIQQSVRVCPSREDFPLIETEHEAYLRRIKMELQQKDQ
ALVELLQEKVGLFAEMTHFQVDEDGGGLTLPTLPRGLFRSESLECPRGERLLQDAIREVE
GLKDLLVGPGVELLLTAREPALPGDLDSGGSTSPGVTANGEAGTFNGSTELCGTDSDSSR
KDRNGNQLRAPQEEALQRLVNLYGLLHGLQAAVAQQDTLMEARFPEGPERREKLARANSR
XRPRGRETVAGQLGRRPRRRRGMGAAGPAELTSRPAAFPAGPSQPSRGHERLDLSVTIRS
VHRPFEDRERQDLGSPEERLQDSSDPDTGSEEEGGCRLSPPHSPRDFTRMQDIPEEIESR
DGEPVASES
Download sequence
Identical sequences M3Y0X6
ENSMPUP00000004977 ENSMPUP00000004977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]