SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004984 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004984
Domain Number 1 Region: 59-143
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000865
Family RING finger domain, C3HC4 0.00026
Further Details:      
 
Domain Number 2 Region: 222-261
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000188
Family RING finger domain, C3HC4 0.0036
Further Details:      
 
Domain Number 3 Region: 136-201
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000459
Family IBR domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004984   Gene: ENSMPUG00000005023   Transcript: ENSMPUT00000005069
Sequence length 336
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896976.1:5767838:5836881:-1 gene:ENSMPUG00000005023 transcript:ENSMPUT00000005069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGGRMERSLEMSGRQEHLVKGLRSLETGEERLMGSGGRTQYLTMTTENPAAGELAPAPL
VTCKLCLCEQSLDKMTTLRECRCLFCTACLKQYLQLAIREGCGSPIACPDTVCLNHGTLQ
EAEIASLVPVDQFQLYQRLKFEREVHLDPHRTWCPVADCQTVCPVASGDPGQPVQVECPS
CHLKFCSCCKDAWHAEVSCRDSQPIVLPTEHRALFGTDAEAPIKQCPVCRVYIERNEGCA
QMMCKNCKHTFCWYCLQNLDNDIFLRHYDKGPCRNKLGHSRASVMWNRTQVVGILVGLGI
IALVTSPLLLLASPCIICCVCKSCRGKKKKHDPSTT
Download sequence
Identical sequences M3Y0Y3
XP_004761324.1.14098 ENSMPUP00000004984 ENSMPUP00000004984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]