SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005008 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005008
Domain Number 1 Region: 409-522
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 8.5e-18
Family Mannose 6-phosphate receptor domain 0.0066
Further Details:      
 
Domain Number 2 Region: 67-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000103
Family LDL receptor-like module 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000005008
Domain Number - Region: 30-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000209
Family LDL receptor-like module 0.0041
Further Details:      
 
Domain Number - Region: 208-256
Classification Level Classification E-value
Superfamily EF-hand 0.000469
Family Polcalcin 0.066
Further Details:      
 
Domain Number - Region: 125-209
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.068
Family FCH domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005008   Gene: ENSMPUG00000005047   Transcript: ENSMPUT00000005093
Sequence length 538
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896921.1:2176720:2190972:-1 gene:ENSMPUG00000005047 transcript:ENSMPUT00000005093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFLLLLPLCWAVEVKRPRGVSLTNHHFYDESKPFTCLDGSATIPFDQVNDDYCDCKDG
SDEPGTAACPNGSFHCSNTGYKALYISSRWVNDGVCDCCDGTDEYNSGIVCENTCKEKGR
KERETLQQMAEVTREGFRLKKILIEDWKKAREEKQEKLAELQAGKKSLEDQVEMLRLVKE
EAEKPEKEAKDQHQKRWEEQQAASRAQRERELAASAFQELDDDLDGAVSVTELQTHPELD
TDGDGTLSEGEAQALLGGDLQTDASAFYDRVWAAIRDKYRSEVLPTSPPPAPSEPDLTEP
KEEQPPVPSPPVEEEEEDEDEEETEEEEEEEEEEEDSQVQGEQPQEAPPPLAPPQPAASP
TEEDKMPPYDEQTQAFIDAAQEARSKFEEAERSLRDMEESIRNLEQEISFDFGPNGEFAY
LYSQCYELTTNEYVYRLCPFKLVSQKPKLGGSPTSLGTWGSWAGPDHDKFSAMKYEQGTG
CWQGPNRSTTVRLLCGKETVVTSTTEPSRCEYLMELMTPAACAEPPPDPPADGDHDEL
Download sequence
Identical sequences M3Y107
XP_004748439.1.14098 ENSMPUP00000005008 ENSMPUP00000005008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]