SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005028 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005028
Domain Number 1 Region: 27-535
Classification Level Classification E-value
Superfamily ARM repeat 2.07e-93
Family Clathrin adaptor core protein 0.001
Further Details:      
 
Domain Number 2 Region: 601-759
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 4.76e-62
Family Coatomer appendage domain 0.000000311
Further Details:      
 
Domain Number 3 Region: 760-853
Classification Level Classification E-value
Superfamily Subdomain of clathrin and coatomer appendage domain 2.55e-29
Family Coatomer appendage domain 0.0000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005028   Gene: ENSMPUG00000005067   Transcript: ENSMPUT00000005113
Sequence length 856
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896904.1:9594392:9717612:1 gene:ENSMPUG00000005067 transcript:ENSMPUT00000005113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKKFDKKDEESGSGSNPFRHLEKSAVLQEARIFNETPINPRRCLHILTKILYLLNQGEH
FGTTEATEAFFAMTRLFQSNDQTLRRMCYLTIKEMATIAEDVIIVTSSLTKDMTGKEDVY
RGPAIRALCRITDGTMLQAIERYMKQAIVDKVSSVSSSALVSSLHMMKISHDVVKRWVNE
AQEAASSDNIMVQYHALGVLYHLKKNDRLAVSKMLNKFTKSGLKSQFAYCMLIRIASRLL
KENEEGHESPLFDFIESCLRNKHEMVIYEAASAIIHLPNCTARELAPAVSVLQLFCSSPK
PALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGSESSVDRL
MKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEYKRAIVDC
IISIVEENPEGKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYIRFIFNRV
VLENEAVRAAAVSALAKFGAQNENLLPSILVLLQRCMMDTDDEVRDRATFYLNVLQQRQM
ALNATYIFNGLTVSVPGLEKALHRYTLEPSEKPFDMKSIPLAVAPVFEQKAEITLVATKP
EKLAPSRQDIFQEQLAAIPEFMDLGPLFKSSEPIQLTEAETEYFVRCIKHMFTNHIVFQF
DCTNTLNDQLLEKVTVQVEPSDSYEVLCCIPAPSLAYNQPGICYTLVRLPDDDSTTVTAT
FSCTMKFTVRDCDPDTGVPAEEGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDTF
EKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKVPENKNSHSLYLAGVYRGGYDLLVR
SRLALADGVTMQLRRS
Download sequence
Identical sequences M3Y127
ENSMPUP00000005028 ENSMPUP00000005028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]