SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005032 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005032
Domain Number 1 Region: 677-944
Classification Level Classification E-value
Superfamily RNI-like 5.1e-63
Family 28-residue LRR 0.0024
Further Details:      
 
Domain Number 2 Region: 17-104
Classification Level Classification E-value
Superfamily DEATH domain 2.35e-16
Family Caspase recruitment domain, CARD 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000005032
Domain Number - Region: 193-298
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000771
Family G proteins 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005032   Gene: ENSMPUG00000005071   Transcript: ENSMPUT00000005117
Sequence length 952
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896987.1:4550666:4617918:-1 gene:ENSMPUG00000005071 transcript:ENSMPUT00000005117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKQGHSEVGIISSESHSHVKLLKIHRELLVTHIRNTQCLVDNLLKNDYFSSEDAEIVGA
CPTQPDKVRKILDLAQSKGEEVSEFLLYVLQQLTDAYVDLRPWLSETGFSPSELIQSKVV
INTDPVSRYTEKLRQQLARDSKFVLCYAQKEELLLEETYSDTIVELVGFSNESLGPLESL
SCLLDHRTGVLSEQGETIFICGDAGVGKSMLLQRLQSLWAAGRLDTEFKFFFHFRCRMFS
CFKEGDTLCLRDLLFKHYCYPEQDPEEVFAFLLRFPQTALFTFDGLDELHSDFDLSSALD
TCSPWEPAHPLVLLTNLLSGKLLKGAGKLLTARTGVEIPRQLLRKKVLLRGFSPSHLRAY
TKRMFPERAVQEHLLAQLEANPNLCSLCAVPLFCWIIFRCFQHFHSIWEGSAQLPDCTVT
LTDVFLLVTEVHLNRTQPTSLVQRNTRGQTETFHASRGTLRSLGQVAHGGMEKSLFVFRQ
EEVQAAGMQEGELQLGFLRAVPEQGLGGDQQSYEFFHITLQAFFTAFFLVVDDKVDTGQL
LRFFQEWAPGGAGAESCYPPCLPFPCLKGSGLAGEDPFKNKDHFQFTNLFLCGLLSKAKQ
KLLRHLVPTAALRRKRKALWAHLFASLRAHLQNLPRVKSGTFNQVQAMPTFVWMLRCIYE
TQSEKVGQLAAKGICANYLKLTFCNVCSADCSALSFVLHHLRKRLALDLDNNNLNDYGVR
ELQPCFSRLTVIRLSVNQITDSGVKVLYEELTKYKILTFLGLYNNQITDVGARYIARILD
ECKGLTHLKLGENKITSEGGKCLAVAVKNSKSIFEIGMWGNRIGDEGAKAFAEALRNHPS
LTNLSLAFNGISREGGKSLAQALEQNTSLRIFWLTKNELDDEVAESLAEMLKVNQTLKHL
WLIQNQITAKGIAQLADALQRNTGIMEICLNGNLIKPEEAKVFEDEKRIICF
Download sequence
Identical sequences M3Y131
XP_004762622.1.14098 XP_004762624.1.14098 ENSMPUP00000005032 ENSMPUP00000005032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]