SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005077 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005077
Domain Number 1 Region: 447-751
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.22e-89
Family p120GAP domain-like 0.0000221
Further Details:      
 
Domain Number 2 Region: 318-428
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000122
Family Synaptotagmin-like (S variant) 0.066
Further Details:      
 
Domain Number 3 Region: 245-317
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000253
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000005077
Domain Number - Region: 78-141,274-306
Classification Level Classification E-value
Superfamily PH domain-like 0.000216
Family Pleckstrin-homology domain (PH domain) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005077   Gene: ENSMPUG00000005113   Transcript: ENSMPUT00000005162
Sequence length 1273
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896982.1:6669360:7023656:1 gene:ENSMPUG00000005113 transcript:ENSMPUT00000005162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSPSSGGAAEALSWPEMFPGLESDSPLPPEELEAVVPVGGAVAGGMLDRILLESVCQQ
QSWVRVYDVKGPPTHRLSCGQSPYTETTTWERKYCILTDSQLVLLNKEKEIPVEGGQEQQ
TDSTKGRCLRRTVSVPSEGQFPEYPPEGATKLEVPAERSPRRRSISGTSTSEKPNSMDTV
NTSPFKVPGFFSKRLKGSIKRTKSQSKLDRNTSFRLPSLRNADDRARGLPKLKESRSHES
LLSPCSAVECLDLGRGEPVSVKPLHSSILGQDFCFEVTYLSGSKCFSCNSASERDKWMEN
LRRTVQPNKDNCRRAENVLRLWIIEAKDLAPKKKYFCELCLDDTLFARTTSKTKADNIFW
GEHFEFYSLPPLHSITVHIYKDVEKKKKKDKNNYVGLVNIPTASVTGRQFVEKWYPVSTP
TPNKGKTGGPSIRIKSRFQTITILPMEQYKEFAEFVTSNYTMLCSVLEPVISVRNKEELA
CALVHILQSTGRAKDFLTDLVMSEVDRCGEHDVLIFRENTIATKSIEEYLKLVGQQYLHD
ALGEFIKALYESDENCEVDPSKCSSSELIDHQSNLKMCCELAFCKIINSYCVFPRELKEV
FASWKQQCLTRGKQDISERLISASLFLRFLCPAIMSPSLFNLMQEYPDDRTSRTLTLIAK
VIQNLANFAKFGNKEEYMAFMNDFLEHEWGGMKRFLLEISNPDTISNTPGFDGYIDLGRE
LSVLHSLLWEVVSQLDKGENSFLQATVAKLGPLPRVLADITKSLTNPTPIQQQLRRFTEH
NSSPNVSGSLSSGLQKIFEDPTDSDLHKLKSPSQDNTDSYFRGKTLLLVQQASSQSMTYS
EKDEKESSLPNGRSISLMDLQDPHAAQMEHASVMLDVPVRLTGSQLSITQVASIKQLREA
QSTPQSAPQVRRPLHPALNQPGSLQPLSFQNPVYHLNNPIPAMPKASVDSSLENLSTASS
RSQSNSEDFKLSGPSNSSMEDFTKRSTQSEDFSRRHTVPDRHVPLALPRQNSTGQAHIRK
MDQAGLGARAKAPPSLPHSASLRSTGSMSVASAALVAEPVQNGSRSRQQSSSSRESPVPK
VRAIQRQQTQQVQSPVDSATMSPVERTAAWVLNNGQYEEDVEETEQNQDESKHAEKYEQE
ITKLKERLRVSSRRLEEYERRLLVQEQQMQKLLLEYKARLEDSEERLRRQQEEKDSQMKS
IISRLMAVEEELKKDHAEMQAVIDAKQKIIDAQEKRIVSLDSANTRLMSALTQVKERYSM
QENIQIPRANQNN
Download sequence
Identical sequences M3Y176
ENSMPUP00000005077 ENSMPUP00000005077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]