SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005083 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005083
Domain Number 1 Region: 197-233
Classification Level Classification E-value
Superfamily WW domain 0.00000000000712
Family WW domain 0.0017
Further Details:      
 
Domain Number 2 Region: 235-270
Classification Level Classification E-value
Superfamily WW domain 0.0000000104
Family WW domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005083   Gene: ENSMPUG00000005119   Transcript: ENSMPUT00000005168
Sequence length 384
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896900.1:5381103:5404508:-1 gene:ENSMPUG00000005119 transcript:ENSMPUT00000005168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSRKKTKNEVSKPAEVQGKYVKKETSPLLRNLMPSFIRHGPTIPRRTDICLPDSSPNAF
SASGDGIVSRNQSFLRTPIQRTPHEIMRRESNRLSAPSYLARSLADVPREYGSSQSFLTE
VNFAVENGDSGSRYYYSDNYFDGQRRRPLGDRAHEDYRYYEYNHDLFQRMPQNQGRHASG
IGRVAATSLGNLTNHGSEDLPLPPGWSVDWTMRGRKYYIDHNTNTTHWSHPLEREGLPPG
WERVESSEFGTYYVDHTNKKAQYRHPCAPSVPRYDQPPPVTYQPQQTERNQSLLVPANPY
HTAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGMLKLLFMKELEQIVKMYEAYRQ
ALLTELENRKQRQQWYAQQHGKNF
Download sequence
Identical sequences M3Y182
XP_004738808.1.14098 XP_006731182.1.47382 XP_021557019.1.83697 ENSMPUP00000005083 ENSMPUP00000005083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]