SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005092 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005092
Domain Number 1 Region: 929-1071
Classification Level Classification E-value
Superfamily TNF-like 1.1e-25
Family TNF-like 0.002
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000005092
Domain Number - Region: 659-734
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0489
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number - Region: 255-333
Classification Level Classification E-value
Superfamily Tropomyosin 0.0523
Family Tropomyosin 0.0077
Further Details:      
 
Domain Number - Region: 448-503
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.0569
Family Fibrinogen coiled-coil and central regions 0.0054
Further Details:      
 
Domain Number - Region: 535-634
Classification Level Classification E-value
Superfamily Tropomyosin 0.0915
Family Tropomyosin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005092   Gene: ENSMPUG00000005128   Transcript: ENSMPUT00000005177
Sequence length 1076
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896906.1:13598526:13652819:-1 gene:ENSMPUG00000005128 transcript:ENSMPUT00000005177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWQPTRPRPRASWRWALALLTLGGAGLCHAGPQPMHPARPGARNKNWCAYIVNKNVSCSV
LEGSESFIQAQYNCPWNQMPCPSALVYRVNFRPRYVTKYKTVTQLEWRCCPGFRGGDCQE
GPRDTVKTPRPTPARPRNSMKKATDNEPSQVSEPKKTLSPTRAAEPSQMVDPKQGPQELQ
EKKIQVLEEKVLRLTRTVLDLQSSIAGVNENLKHAIQDDASKMLASWLSNLHPQQVPDSA
VGGDTETVQLPDVLNNKESGMKDIKSELAEVKDALKTKSDKLEELDGKVKGYEGQLRQLQ
EAAQGPTVTMTTNELYQAYVDSKIDALREELMEGMDRKLADLKNSCEYKLIGLQQQCDDY
GSSYLGVIELIGEKETNLRKEINDLRARVQDPSAQSDCCGGKKNGDFGQQIKMLDQKIER
VAEATRMLNARLDNEFDRLAVPEPDVDFDARWNELDARINVTEKNAEEHCFYIEETLRGA
INGEVHDLKQLLDHKIQSLEERLGSVLSEVANSTEAELTPSASALPAVSGAGNKQVLIEL
NHLKNKVQVVEDICLQNFPREPHGIEDTLPNGEDHLMGDSLNLLKSLNDTMHRKFQETER
SIQKLQQDFRFLYSQLNHTEDDVNQLQNELNSCREGKNTAVGGFSKGGEHGRTVEPLPSP
RDPLAPCCSQLEERWQQLQNRVLSELDACKENTHGVQRDVSVVENRVSHLEKTCSKLDSI
SGSLQRIKEGLNKHVGSLWSCVRQMNGTLRSHSRDISGLKNSVQQFYSHVFQISTDLQDL
IRFQPSATEEPSEAPPSGALVEAPTEASHPEPTPLPTPSAPPLSEDPRKRPHMGQQPILP
KKPPQPLPPPAWPGWTGLPFLPGSTGVIMETGEAGPPGRMGMSGRGLPQGVDGQSGQRPI
PSTEGFAGAPGYPNSPPAAPPGVPVPSLVSFSAGLTQKPFPSDGGVVLFNKVLVNDGDVY
DPDTGIFTAPYDGRYLITATLTPERDAYVEAVLSVSNASVAQLHTAGYKREFLEYHRPQG
ALHTCGGPGAFHLIVHLKAGDGVNIVVTGGRLAHTDFDEMYSTFSGVFLYPFLSHL
Download sequence
Identical sequences M3Y191
ENSMPUP00000005092 ENSMPUP00000005092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]