SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005094 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005094
Domain Number 1 Region: 116-227
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.93e-18
Family Synaptotagmin-like (S variant) 0.021
Further Details:      
 
Domain Number 2 Region: 254-433
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000000175
Family Integrin A (or I) domain 0.028
Further Details:      
 
Domain Number 3 Region: 15-106
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000118
Family PLC-like (P variant) 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005094   Gene: ENSMPUG00000005130   Transcript: ENSMPUT00000005179
Sequence length 500
Comment pep:novel scaffold:MusPutFur1.0:GL897112.1:2725971:2727502:-1 gene:ENSMPUG00000005130 transcript:ENSMPUT00000005179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKEMAHCVTLIQLSISCDHLIDKDIGSKSDPFCILLQDVGKGSWTELGQLSEYGTVQAPS
SPRLQLEYHFETIQKLRFGIYDIDNELGNDFLGGAECSLEEVSTQNMKDSRIVTMEVEAK
NLDKDFLEKLDPFLEFFHQGDGKRHLAYRSEVIKNNLNPTWKHFSVSLQHFCGGHPSTPI
QVQCSDYDSDGSHDLIGTFYTSLAQLQAVPTEFDWIHPEKKQKKKICKNTVTVCVKICQV
ETQYSFLDYVMRGCQINFTVDIDFTGSNGDPSSSNSLYYLSPAGVNEYLTALWSVGSIIQ
DYDSDKLPAFGFGAQVSHEFALNFDCNNPYCTGFQGIVDAYHQALPQVHLYSTTNFVAII
NHARLATQAAYQRTALQYFVLLLLTNGAVTDVEATCEAVVHASHLPMSVIIVGVGGADFE
AMEQLDADGGPLHACSGVAAACDIGQFVSYHHFQNSPESLAQTVLAEVPTQLVSYFKAQG
WAPLKPLPPPVKSPAHAPQA
Download sequence
Identical sequences M3Y193
ENSMPUP00000005094 ENSMPUP00000005094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]