SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005109 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005109
Domain Number 1 Region: 34-290
Classification Level Classification E-value
Superfamily Ras GEF 8.37e-81
Family Ras GEF 0.0000421
Further Details:      
 
Domain Number 2 Region: 458-576
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000336
Family Pleckstrin-homology domain (PH domain) 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005109   Gene: ENSMPUG00000005145   Transcript: ENSMPUT00000005194
Sequence length 583
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896982.1:7234136:7384263:1 gene:ENSMPUG00000005145 transcript:ENSMPUT00000005194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLMNGQASNVNIAAVASEKSSSSESLSDKGSELKKSFDAVVFDVLKVTPEEYAGQITLM
DVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAEV
LSHYIKTAKKLYELNNLHALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSKE
DNYKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRIIS
DLQQSCEYDIPMLPHVQKYLNSVQYIEELQKFVEDDNYKLSLKIEPGTSTPRSAASREDL
VGPEVGASPQSGRKSMAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKMNTAEFKSA
TFPNAGPRHLLDDSVMEPHAPSRGQAESSTLSSGISIGSSDGSELSEETSWPAFERNRLY
HSLGPVTRVARNGYRSHMKASSSAESEDLAVHLYPGAVTIQGVLRRKTLLKEGKKPTVAS
WTKYWAALCGTQLFYYAAKSLKATERKHFKSTSNKNVSVVGWMVMMADDPEHPDLFLLTD
SEKGNSYKFQAGNRMNAMLWFKHLSAACQSNKQQVPTNLMTFE
Download sequence
Identical sequences M3Y1A8
ENSMPUP00000005109 XP_004762043.1.14098 ENSMPUP00000005109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]