SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005140 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005140
Domain Number 1 Region: 1431-1501
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000998
Family SH3-domain 0.0025
Further Details:      
 
Domain Number 2 Region: 996-1170
Classification Level Classification E-value
Superfamily RUN domain-like 0.00000000562
Family RUN domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005140   Gene: ENSMPUG00000005178   Transcript: ENSMPUT00000005227
Sequence length 1511
Comment pep:known scaffold:MusPutFur1.0:GL896918.1:1255485:1325404:1 gene:ENSMPUG00000005178 transcript:ENSMPUT00000005227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLFEISRMDSPPKLAGETLIVHHIPLVHCQVPDRQCCGGASGGSGSTRSNPFCPPDLGI
TQPDQDLGQADSLLYNSLHSAAGGSARPADSTKSRVRDGRGPGAPKRHNPFLLQEGAAEP
GLSDLYDDSIGDSATQQSFHLHGAGQPTFHLSPFQLPPPGPRAGRPWGAMRSRAGVVEGQ
EQEPVATLESQHCSPSHCCRPDLEAETMELDECGGPGGSGSGGGASDTSGFSFDQEWKLS
SDESPRNPGCSGSGPQHCRCSSTSSQSEAADQSMGYVSDSSCNSSDGVLVTFSTLYNKMH
GNSRANLNSAPQSCSNSSFCSHSDPGAFYLDLQPSPAESKMSCESHHPDSGGREGSYGCP
HASSPELDANCNSYRPHCEPCPGVADLTACFQSQARLVVATQNYYKLVTCDLSSQSSPSP
AGSSITSCSEEHTKISPAPGPGPDPGPSQPSEYYLFQRPEVQTEEQGVVGSSVEAAAPMG
PGVIEGQVYTNTSPPNLSTGRQRSRSCDRSLARSPPVRLGSLERMLSCPVRLSEGPAALA
GPGSPPRRVTSFAELAKGRKKAAGSGSPPLRVSIGDSSQEFSPIPEAQQDRVGPLDEGTR
CSHSLPPMPSGPGMDIIGPESWSTQVCQGPQSSEMPPASLRAAGQGPLAQLMDPGSALSG
SPANSHTQKDARARADGGGADSRPVLRYSKEQRPTTLPIQPFVFQHHFPKQLAKARALHS
LSQLYGLSGCSRAQQPAPLAAPTAQVPALAPSGESQAPANRGARKAGPEPETSRPSPLGS
YSPIRSAGPFGPSTDSSASTSCSPPPEQATATESPPPWSRSCPPVARPATSQQPQKEDQK
LLTLAEYRLHGTGSLPPLGSWRSSLSRAESLARGGGEGSMASRPNNANHLSPQALKWREY
RRKNPLGPPGLSGSLDRRPQDARLARRNPIFEFPGSFSAAGHLNCRLNGQIVKPLPLTCP
DFQDPFSLTEKPPAEFCLSPDGNSEAISIDLLQKKGLVKAVNTAVDLIVAHFGTSRDPGV
KAKLGNSSVSPNVGHLVLKYLCPAVQAVLEDGLKAFVLDVIIGQRKNMPWSVVEASTQLG
PSTKVLHGLYNKVSQFPELTSHTMRFNAFILGLLNIRSLEFWFNHLYNHEDIIQTHYQPW
GFLSAAHTVCPGLFEELLLLLQPLALLPFSLDLLFQHRLLQSGQQQRQHKELLRVSQDLL
LSAHSTLQLARARGQEGPGDMDRAVHGERVKGVGAPEGGEDEEEEETEEVAEAAGGSGRG
RWARGGQAGWWYQLMQSSQVYIDGSTEGSRFPRGGSNSSEKKKGAGGGGPPPREGVVEGA
EACPAPEETLGRDRGWPFWMGSPPDSVLAELRRSREREGSTAPPAENEEGASEPSPGGIK
WGHLFGSRKAQRETRPTNRLPSDWLSLDKSMFQLVAQTVGARREPEPKESLQEPHSPVLP
SKPPCEVKALCHHLATGPGQLSFHKGDILRVLGPAGGDWLRCSRGPDTGLVPLAYVTLTP
TPSPTPGSSQN
Download sequence
Identical sequences M3Y1D9
XP_004747577.1.14098 XP_004747578.1.14098 XP_012909194.1.14098 XP_012909195.1.14098 ENSMPUP00000005140 ENSMPUP00000005140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]