SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005157 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005157
Domain Number 1 Region: 238-358
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000104
Family Synaptotagmin-like (S variant) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005157   Gene: ENSMPUG00000005194   Transcript: ENSMPUT00000005244
Sequence length 660
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896924.1:7841171:7849667:1 gene:ENSMPUG00000005194 transcript:ENSMPUT00000005244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DTQPRRAPEPARAQRELGVWRSLLRLRPTRAGAPEEPGVRGLLASLFAFKSFRENWQRAW
VRALNEQACRDGSSIQIAFEEVPQVPPRASISHVTCVDQSDRTMVLHCQLSAEEVMFPVS
VTQQSPAAVSMETYHVTLTLPPTQLEVSLEEIPDEGLLVSWAFTDRPDLSLTVLPKLQAR
ERGEEQVELSTIEELIEDAIVSTQPAMMVNLRACSVPGGPVPSEKPPMVPQAQPAISRPT
RLFLRQLRASHLGSELEGTGELCCVAELDNPVQQKWTKPVSAGPEVEWTEDLALDLGPQS
RELSLKVLKSSSCGDSEILGQITLSVGPPSRPLSRRQVCPLTPGPGKALGPAATMAVELQ
YEEGSPRNLGTPTPSTPRPSITPTKKIELDRTIMPDGTIVTTVTTVQSRPRVEGKLDSPS
RSPSKVEVTEKTTTVLSESSGPSSTSHSSSRESHLSNGLDPVAETAIRQLTEPSGRAAKK
TPTKRSTLIISGVSKVPIAQDELALSLGYAASLDASMQEDAGTSGGPSSPPSDPPATSPG
PLDALSSPTSVQEADETTRSDISERPSVDDVESETGSTGALETRSLKDHKVSFLRSGTKL
IFRRRPRQKEAGLSQSHDDLSNTTATPSVRKKAGSFSRRLIKRFSFKSKPKANGNPSPQL
Download sequence
Identical sequences M3Y1F6
ENSMPUP00000005157 ENSMPUP00000005157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]