SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005158 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005158
Domain Number 1 Region: 297-434
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.46e-33
Family Synaptotagmin-like (S variant) 0.002
Further Details:      
 
Domain Number 2 Region: 10-129
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.45e-26
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0015
Further Details:      
 
Domain Number 3 Region: 475-600
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.57e-20
Family Synaptotagmin-like (S variant) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005158   Gene: ENSMPUG00000005195   Transcript: ENSMPUT00000005245
Sequence length 609
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897057.1:2996117:3067187:-1 gene:ENSMPUG00000005195 transcript:ENSMPUT00000005245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAREVSLNSLQELEREVILQVLYRDQAVQNIEEERIRKLKTHLQHLRWKGAQGVSQEHRE
KSCARCQSELGFLLNRGAVCKGCSHRVCSECRVFLRKTSAWKCTVCFEDRNVKIKTGEWF
FEERAKKFPTESKHATAGAKLLQSYQELSKISVVPPTPPPLSESQCSSSSQRLQELGQFK
GFNKSVENLFLSVTTHMKKLSKSQNDMTSDKQLLATGPRQCASRTERRSLSDTAINVTTR
KASAPDILKPLNQESPKRLPNPVPKPENLSSRPTPSALFSGGLRHASLTSINSACTEMGN
FDNASVTGEIEFAVRYCFKTCSLEICIKACKNLAYGEEKKKKCNPYVKTYLLPDRSSQGK
RKTGVQKNTVDPTFQETLKYQVEPWQLGTRRLQVSVWHLGTLARRVFLGEVTIPLATWDF
KDSATQCFCWYPLRAKAEKLEESFLSNNGELAVRAKLVFPTGPRKLQKTQEGTDGPSPNG
QLCLVVLGAKNLPVRSDGTLNSFVKGCLTLPDQQKLKLKSPVAKKQACPQWKHSFVFNGV
SPSQLRQSSLELSVWDQAIFGVNDRLLGETRLSSEEEVAGEDSCSESAHQWQKVLESPNL
WTDMTLTLH
Download sequence
Identical sequences M3Y1F7
ENSMPUP00000005158 ENSMPUP00000005158 XP_004770921.1.14098 XP_012900396.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]