SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005185 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005185
Domain Number 1 Region: 56-216,332-489,522-617
Classification Level Classification E-value
Superfamily Ras GEF 3.14e-98
Family Ras GEF 0.00024
Further Details:      
 
Domain Number 2 Region: 751-844
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.4e-38
Family Ras-binding domain, RBD 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005185   Gene: ENSMPUG00000005222   Transcript: ENSMPUT00000005272
Sequence length 844
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896921.1:2201666:2214566:1 gene:ENSMPUG00000005222 transcript:ENSMPUT00000005272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARLRVQAPVQDWGEEAEDGAVYSVSLRRQLSQRLSPRAAPGASQASNPAADAFLHYRTSK
VRALRAARLERLVQELVSGDREQDPGFVPAFLATHRAFASTARVLGLLLPPPPPPLPPGV
LDPAFPTPKSPQPPSSPDGRVAFPRTEIKKAVVSVLGSWLRDHPQDFRDPPAHSDLGSVR
TFLGWAAPAGPEAQEAEKLLGAFLEEAEQKQEEEEKPEAWTGEGYRVPEQAFPCIICPPV
AVFAQLVPFSDLQANIAFHSGTPLENPTTEKPPLTTDRSCSKPKTPLFPTLACSVTRYLG
TPSGPPGAVHSPRPDSPEDCSEAEAGPVREGPELLDFSVDELAEQLTLLDVELFARVRSC
ECLGSVWSQRDRPGAASTAPTVRATVTQFNLVTGCVLGSVLGEQGLAAPQRAQRLEKWIR
VAQRCRELRNFSSLRAILSALQSNPIYRLKRSWGAVSRERLSTFRKLSQIFSDENNHLSS
REILSQQIRIRGQGTGSSEFSSCWVPGTVPVVAESKTGVCAGPVPYLGTFLTDLVMLDTA
LPDMLEGDLINFEKRRKEWEILAHIQQLQKRCGSYCLSPRAPVLAALRAQCQLSEEQSYR
VSRVIEPPAASCPSSPHVRRRISPTKRLSAEAAPGASPGSSSSLVSVFRKLSRERRSSPA
GSPGDPSSPTPSLSPGSPPSSPRTRDPPGSPPASPGPQGPNTKVLGSACVGGHKTPPPTQ
PPSSHCLQLPLSLDLPALRLLALPLSSSHISVPGQPGSEARVIRVSIDNDHGNLYRSILL
TSQDKAPSVVQRALEKHNVAQPWARDYQLFQVLPGDRELLIPDNANVFYAMSPAAPGDFV
LRRK
Download sequence
Identical sequences M3Y1I4
ENSMPUP00000005185 ENSMPUP00000005185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]