SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005196 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005196
Domain Number 1 Region: 554-817
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.07e-80
Family Protein kinases, catalytic subunit 0.0000187
Further Details:      
 
Domain Number 2 Region: 399-509
Classification Level Classification E-value
Superfamily PH domain-like 7.33e-36
Family Pleckstrin-homology domain (PH domain) 0.000000723
Further Details:      
 
Domain Number 3 Region: 118-190
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.69e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.001
Further Details:      
 
Domain Number 4 Region: 258-315
Classification Level Classification E-value
Superfamily Cysteine-rich domain 8.37e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005196   Gene: ENSMPUG00000005234   Transcript: ENSMPUT00000005284
Sequence length 878
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897027.1:3467204:3499100:1 gene:ENSMPUG00000005234 transcript:ENSMPUT00000005284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASPSHLAGLPGSPGPGSPPPPGGLELQSPPPQLAQVPAPSSGVSFHIQIGLTREFVLL
PTASELAHVKQLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSVGDIQEGDL
VEVVLSASATFEDFQIRPHALTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRC
AFSIPNNCSGARKRRLSSTSLASGHSVRLSTSESLPCMADELSRSTTELLPRRPPSSSSS
SSASSYTGRPIELDKMLLSKVKVPHTFLIHSYTRPTVCQACKKLLKGLFRQGLQCKDCKF
NCHKRCATRVPNDCLGEALINGDVPMEEATDFSEADKSSLMDESDDSGIIPGSHSENALH
ASEEEEGEGGKAESSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWR
LDCKCITLFQNNTTNRYYKEIPLSEILTVEPAQNFSLVPPGTNPHCFEIVTANVTYFVGE
TPGGAPGGPSGQGAEAARGWETAIRQALMPVILQDAPSAPGHTPHRQASLSISVSNSQIQ
ENVDIATVYQIFPDEVLGSGQFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEVA
ILQSLRHPGIVNLDCMFETPEKVFVVMEKLHGDMLEMILSSEKGRLPERLTKFLITQILV
ALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAP
EVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDIKDQIQNAAFMYPACPWSRISSGA
IDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELEGKMGERYITHESDDARWEQF
VAEHPLPGPGLPADGDFEGTLLPQDHEMQGLAERISVL
Download sequence
Identical sequences M3Y1J5
XP_004767573.1.14098 XP_004767574.1.14098 ENSMPUP00000005196 ENSMPUP00000005196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]