SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005203 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005203
Domain Number 1 Region: 110-218
Classification Level Classification E-value
Superfamily Second domain of FERM 1.05e-28
Family Second domain of FERM 0.0027
Further Details:      
 
Domain Number 2 Region: 220-364
Classification Level Classification E-value
Superfamily PH domain-like 7.68e-25
Family Third domain of FERM 0.0026
Further Details:      
 
Domain Number 3 Region: 16-110
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.23e-16
Family First domain of FERM 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005203   Gene: ENSMPUG00000005241   Transcript: ENSMPUT00000005291
Sequence length 614
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896900.1:6312727:6349193:1 gene:ENSMPUG00000005241 transcript:ENSMPUT00000005291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLNFHNNRVMQDRRSVCIFLPNDESLNIIINVKILCHQLLVQVCDLLRLKDCHLFGLS
VIQNNEHVYMELSQKLYKYCPKEWKKEASKGIDQFGPPMIIHFRVQYYVENGRLISDRTA
RYYYYWHLRKQVLHSQCVLREEAYFLLAAFALQADLGNFKRNKHYGKYFEPEAYFPSWVV
SKRGKDYILKHIPNMHKDQFALTASEAHLKYIKEAVRLDDVAVHYYRLYKDKREIEASLT
LGLTMRGIQIFQNLDEEKQLLYDFPWTNVGKLVFVGKKFEILPDGLPSARKLIYYTGCPM
RSRHLLQLLSNSHRLYMNLQPVLRHIRKLEENEEKKQYRESYISDSLDLDVDQLEKRSRA
SGSSAGSVRHKRLSRHSTASHSSSHTSGIEADTKPRDAGPEDSYSGSAIHRKLKTCSSMT
SHGSSHTSGVESSGKDRLEEDSQDDEIEMLVDDPRDLERMNEESLEVSPDMCIYITEDML
LSRKLNGHSGLIVKEIGSSTSSSSETVVKLRGQSTDSLPQTICRKPKTSTDRHSLSLDDI
RLYQKDFLRIAGLCQDTAQSYTFGCGHELDEEGLYCNSCLAQQCVNIQDAFPVKRTSKYF
SLDLTHDEVPEFVV
Download sequence
Identical sequences M3Y1K2 U6CRU7
ENSMPUP00000005203 ENSMPUP00000005203 XP_004738836.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]