SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005214 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005214
Domain Number 1 Region: 18-229
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.46e-44
Family DBL homology domain (DH-domain) 0.00046
Further Details:      
 
Domain Number 2 Region: 217-349
Classification Level Classification E-value
Superfamily PH domain-like 8.49e-17
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005214   Gene: ENSMPUG00000005252   Transcript: ENSMPUT00000005302
Sequence length 350
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896918.1:1376191:1380175:-1 gene:ENSMPUG00000005252 transcript:ENSMPUT00000005302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGLRPEEPTPQLGMEKWGASGRCTVQEQRARWERKRACTARELLETERRYQEQLGLVA
TYFVGILKAKGTLRPAERQALFGPWELIYGASQELLPYLEGGHWGQGLESFCPHLELYTE
FAANAERSRTTLQEQLKKNKRFRRFVRLQEGRPEFGSLHLQDLLPLPLQRLQQYENLVVA
LAENTGPNSPDQQQLTRAARLISETAQRVYSIGQKQKNDQHLRRVQALLSGRQAKGLTSG
RWFLRQGWLLVVPPHGEPRPRMFFLFSDVLLMAKPRPPLHLLQSGTFACRALYPMAQCQL
HRVFGHSGGPCGGLLSLSFPHEKLLLMCTDQEELLHWHHSLTLAISSQKN
Download sequence
Identical sequences M3Y1L3
ENSMPUP00000005214 ENSMPUP00000005214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]