SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005230 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005230
Domain Number 1 Region: 292-428
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.12e-34
Family Synaptotagmin-like (S variant) 0.00001
Further Details:      
 
Domain Number 2 Region: 150-274
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.03e-33
Family Synaptotagmin-like (S variant) 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005230   Gene: ENSMPUG00000005268   Transcript: ENSMPUT00000005318
Sequence length 431
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897177.1:1061195:1079159:-1 gene:ENSMPUG00000005268 transcript:ENSMPUT00000005318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEITNIRPSFDVSPVVAGLVGASVLVVCVSVTVFVWTCCHQRAEKKHKTPPYKFIHMLK
GISIYPETLSNKKKIIKVRRDEDGPGRGGGRGSVMVDAAEAGLLGPDRGPKGPGSGSCMD
QLPIKVDHGEELRSPVASLTPGESKTTSPSSPEEDVMLGTLTFSVDYNFPKKALVVTIQE
AHGLPVMDEQTQGSDPYIKMTILPDKRHRVKTRVLRKTLDPVFDETFTFYGIPYSQLQDL
VLHFLVLSFDRFSRDDVIGEVMVPLAGVDPSTGKAQLTRDITKRNIQKCISRGELQVSLS
YQPVAQRLTVVVLKARHLPKMDITGLSGNPYVKVNVYYGRKRIAKKKTHVKKCTLNPVFN
ESFVYDIPPDLLPDVSIEFLVIDFDRTTKNEAVGRLILGAHSVTSSGAEHWREVCEKPRK
PVAKWHSLSEY
Download sequence
Identical sequences M3Y1M9
XP_004778617.1.14098 ENSMPUP00000005230 ENSMPUP00000005230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]