SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005235 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005235
Domain Number 1 Region: 401-608
Classification Level Classification E-value
Superfamily PUA domain-like 9.44e-78
Family SRA domain-like 0.00000000347
Further Details:      
 
Domain Number 2 Region: 1-78
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.9e-19
Family Ubiquitin-related 0.000018
Further Details:      
 
Domain Number 3 Region: 710-768
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000239
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 4 Region: 297-365
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000997
Family PHD domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005235   Gene: ENSMPUG00000005273   Transcript: ENSMPUT00000005323
Sequence length 791
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897062.1:1416519:1444358:1 gene:ENSMPUG00000005273 transcript:ENSMPUT00000005323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWIQVRTMDGKVTHTVDSLSRLTKVEELRRKIQEVFHVEPGLQRLFYRGKQMEDGHTLFD
YDVRLNDTIQLLVRQSLVLPASSVKERDSELSDTDSGCCLGQSESDKSSNSGEAASEADG
KAGLADEDTWDETELGLYKANEYVDARDTNMGAWFEAQVVRVTRKAPSSAEPCSSSSTPE
DDVIYHVKYDDYPENGVVQMSSRDVRARARHIFKWQELEVGQEVMLNYNPDNPKERGFWY
DAEIVRKRETRTARELYANVRLGGGSLNDCRIIFVDEVFKIELPGEGSPVVENPMRRKSG
PSCKHCKDDENKTCRVCACHLCGGKQDPDKQLMCDECDMAFHIYCLCPPLSSIPKEDEWY
CPECRNDASEVVLAGEKLKESKKKAKMASATSSSQRDWGKGMACVGRTKECTIVPSNHYG
PIPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNSFTYT
GSGGRDLSGNKRTAEQSCDQKLTNTNRALALNCSAPINDRKGAEAKDWRSGKPVRVVRNV
KGRKHSKYAPAEGNRYDGIYKVVRYWPEKGKSGFLVWRYLLRRDDTEPGPWTKEGKDRIK
KLGLTMQYPEGYLEARARKEKEKENSKREAQEDEEEMEEEGTFTSPRKGKRKTKSGGGRA
GAGSPGGTPKKSKVEPYSLTAQQSSLIKEDQSNTKLWSEILKSLKDGTFQKFLSKVEEAF
QCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQAAL
NQLFPGYGNGR
Download sequence
Identical sequences M3Y1N4
ENSMPUP00000005235 ENSMPUP00000005235 XP_012900854.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]