SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005237 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005237
Domain Number 1 Region: 167-495
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.07e-109
Family Protein serine/threonine phosphatase 0.0000000000226
Further Details:      
 
Domain Number 2 Region: 26-155
Classification Level Classification E-value
Superfamily TPR-like 1.87e-32
Family Tetratricopeptide repeat (TPR) 0.000000345
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005237   Gene: ENSMPUG00000005275   Transcript: ENSMPUT00000005325
Sequence length 499
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897027.1:3680142:3700942:-1 gene:ENSMPUG00000005275 transcript:ENSMPUT00000005325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPS
NAIYYGNRSLAYLRTECYGYALADATRAIEIDKKYIKGYYRRAASNMALGKFRAALRDYE
TVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYSGPK
LEDGKVTITFMKELMQWYKDQKKLHRKCAYQILVQVKEALSKLSTLVETTLKETEKITVC
GDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLL
RGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDG
VTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSVSKRGVSCQFGPDVTKAFLEENHL
DYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLRGSDLRPQFHQFTAVP
HPDVKPMAYASTLLQLGMM
Download sequence
Identical sequences D2HL56 M3Y1N6
ENSMPUP00000005237 XP_002923098.1.58354 XP_004401006.1.74151 XP_004767584.1.14098 ENSMPUP00000005237 ENSAMEP00000009058 ENSAMEP00000009058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]